KEGG   Granulicella tundricola: AciX9_0086Help
Entry
AciX9_0086        CDS       T01411                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
acm  Granulicella tundricola
Brite
Enzymes [BR:acm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     AciX9_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
99124..102231
Genome map
AA seq 1035 aa AA seqDB search
MSTEQSFFERPILNSPYLPSHRHWELDSEGQPTHLIVPTRRRAEFISPIPKPRLRRGQGR
QAALVLQDEAGLSTDTQQYASTIINDLRGEVDAWRRLPSRSDWKVSAETARLLAHWRSDS
FTSVRPFFCQVEAVETVIWLMEVAPLRESWRKKYLNHLSESNADANPGLARLALKLATGA
GKTTVMAMLIAWQTINAVRRPKSQFTKGFLIVAPGLTIRDRLNVLKPNDTYNYYEHRDLV
PKDMLQDMQRAVVVIENYHKFKIRERTSLAKGTRRMLEGRDGEVQTLETEGQMLQRVVGD
LMGMKNILVINDEAHHCYREKSGETAEREIGADEREEAKANAEAARVWITGLEMVKRHIG
ISRILDLSATPFFLRGSGYREGTLFPWTMSDFSLMDAIECGIVKLPRVPVTDNITSADVP
IFRNLWENISKDMPKKGAGKAGLLEPERLPLKLKAALDALYSHYKKTFELWQQNGIEVPP
CFIVVCNNTSASKLVSDYISGYARETPEGSVPIPGHLPLFRNEDENGRPYSRPRTILVDS
HQMEAGGDLDENFRKAAAAEIERFRQELRARGEHDKAANLTDSDLLREVMNTVGRKGALG
ESVRCVVSVSMLTEGWDTQTVTHVLGVRAFGTQLLCEQVIGRALRRQSYELITEGAEAGH
LPVEYADVLGIPFDFTAKSVPAPPQAPRKVISVKALKERAGLEINFPRVQGYRVVMPRER
LAAEFNEDSAYVLTPNEVGPTDTRIEGIVGEGINIGPDHLREARYSTIVFELVSHMLKTS
WKDAQIERPGPHLFMDLKRIAREWLDNYLQCVGGTQPAQMLDPRLLERASQRITTGITRR
MSGETGIAAILDPYNPLGSTAQVNFNTTKTDLWKTAPDRCHVNWVVLDSMWEGEFCRVAE
QHARVRCYVKNHALGFEVPYQRGAENHIYRPDFIVRVEDGHGEDDLLSLVVEIKGYRGED
AKDKRSTMETLWLPGINRTGSHGRWAFAEFTSAYAIEEEFKARVESLFHEMIADASLYGR
QHQPSARDKKEDTNG
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccgagcagagtttcttcgaacgtcccattctgaacagtccctatctgccttct
caccgtcactgggagcttgacagtgaaggccagcctactcacctgattgtgcccacccgg
cggcgagccgagttcatctcgcccatcccgaagccgcgactgcggcggggtcagggacga
caagctgcactggtgttgcaggacgaggctggcctctcgacggacactcagcaatacgcc
tccaccatcatcaacgacctgcgcggcgaagtcgatgcttggcgaaggctgccaagtcgg
tcggactggaaggtctccgccgagactgcaaggcttcttgcccactggcgaagcgacagt
ttcacgtccgtccgccctttcttctgccaggtggaagcggtcgagaccgtcatctggctg
atggaggttgcacctctacgagagagttggcgtaagaagtatctcaaccacctgtccgaa
tcgaacgcggacgccaatcctggcctggcacgccttgcattgaaacttgcgacaggtgcc
ggtaagacgaccgtgatggcgatgcttattgcctggcagacgatcaatgcggtgcgtcgg
cccaagagccagttcacgaaaggctttctcatcgttgcccctggattgacaatccgggat
cggctcaacgtcctcaagcccaacgacacctataactactacgagcatcgggacctcgtt
ccaaaggacatgttgcaggacatgcaacgtgctgtagtcgtcattgagaactaccacaag
ttcaagatcagggagcggacttctctggctaaagggacccgccgaatgctggaggggcgc
gacggagaggtacagactctggagacagaaggccagatgctgcagcgagtcgtcggggac
ctgatgggaatgaagaacatactggtcataaatgacgaagctcaccactgttatagggag
aagtcaggagagaccgccgagcgggagattggcgctgatgaacgagaggaagcgaaggca
aacgctgaagccgctcgagtttggatcaccggtctggagatggttaagcgtcacatcgga
atctcacgcatcctggacctgtccgccactcctttcttcttgcgaggttcaggataccgg
gagggcacgctcttcccttggaccatgagtgatttttccctcatggatgccatcgaatgc
ggaatcgtgaagctgccgcgagtaccggtgacggacaacataacaagcgctgacgtgcca
atcttccgcaatttatgggagaacatcagtaaggacatgccaaagaagggggctgggaag
gcaggattgctggagccggagcgcctgccgctgaagctgaaagccgccctcgacgctctc
tacagccactacaagaagacctttgagctgtggcaacagaatggcattgaggttccgccc
tgcttcatcgtggtctgtaacaacacctcagcttctaagctggtctctgactacatctct
ggttacgcccgcgagacgcccgaaggcagcgtacccatccccgggcatctgcctctcttc
cgaaacgaagatgagaacggacgtccttactcccggccacgcaccattctcgtagatagc
caccagatggaagcgggcggtgaccttgatgaaaactttcgcaaggcggcagcggcagag
attgagcgcttccggcaggaactgcgggcgcgtggagagcatgacaaggctgccaaccta
accgactccgatctacttcgcgaggtgatgaacacggtgggccgcaaaggtgccctcggg
gagtcggtgcggtgcgtcgtctcggtttcaatgctcactgaaggttgggatacccagacg
gtcacgcatgtcctgggcgttcgagccttcggtacgcagctcctgtgtgagcaggtcatc
ggtcgtgcgctgcgacgccagtcctatgaactcatcacggaaggggcggaagcgggacac
cttcccgtggagtatgccgacgtccttggcattccgttcgacttcaccgccaagtctgtt
ccagcaccaccgcaggctcctcggaaggtcatcagcgtgaaggcactcaaggagcgtgct
ggccttgagatcaacttccctcgtgtgcaaggctatcgagtcgtcatgccacgtgagcgc
ctggctgcggagttcaacgaggactccgcatacgtccttaccccgaatgaggtcggcccc
acagacactcggatcgaaggaatcgtaggcgaaggcatcaacatcggcccagaccatctc
agagaggcccgttactccacaatcgtctttgagcttgtctcacacatgctgaagacgtcg
tggaaagatgcccagatagagcgtcccggaccgcatctcttcatggatctgaagcgcatt
gcccgggagtggttggacaactaccttcagtgtgttggcggcacacagccagcccagatg
ctggacccccgactactggaaagggcttcgcagcgtattactacgggcatcacgcgcagg
atgagcggggagacgggtatcgccgctatcctagatccttacaatccacttggttcaacc
gcgcaggtgaacttcaacaccaccaagactgatctttggaagaccgctccggatcgctgc
cacgtgaactgggtggtgcttgacagcatgtgggaaggggagttctgccgggttgcggaa
cagcacgcacgggtgcggtgctacgtgaagaaccatgcgctgggctttgaggttccttac
cagcgcggcgcggagaaccacatctatcggccggacttcattgtccgcgtggaggatggg
catggggaggacgatctcctcagcctggttgtggagattaagggataccgtggcgaggac
gccaaagacaagcgcagcaccatggagacgctgtggctaccgggcatcaatcgtaccggc
agccacggacgctgggcattcgctgagttcacctcagcctatgcgattgaggaagagttc
aaggcgcgggttgagtcgctctttcacgaaatgattgcggatgcgtcgctgtacgggcgg
cagcaccagccctcagcgagagataagaaggaagatacgaatggctga

DBGET integrated database retrieval system