KEGG   Granulicella tundricola: AciX9_0130Help
Entry
AciX9_0130        CDS       T01411                                 

Definition
ANTAR domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acm  Granulicella tundricola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciX9_0130
Enzymes [BR:acm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AciX9_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
149811..151484
Genome map
AA seq 557 aa AA seqDB search
MAHASFDGLRVLSLESRRAKEVEKLIRTYGGQPFVVPFMREVKLESNHAALDFADRLMRG
ELDVVIFMTGVGVRALLEIVETRYSRTEFLEALGRIKIVTRGSKPEAALRELKLRSVATA
SEPTTWHELMSAMHAYFGDSLKDQRIALQEYGASNPELLAELTECSASVFKVPVYQWALP
HDLKPLRECVHGLTHASVDVVLFTTAVQVIHLMLIAQEMNQVAEMLAGLRSVVVVSVGPT
TTAELLHYGIPPDFEPSRPKMGFLINEAAQYSAQVLQGKRQRASLPPEEEFEPAPAPGEP
LTHVAQSRHAVRRVAESTPTMAGFSDGLSSFDFLHEISRRLAASDPLHTVLDRILEFVTT
MIPCDSCFLYTLEGEKLVLRASRNPHADIVDSLGIKLGQGITGWVAEHREPVAIASRASE
DPRFSKFKNIPEDTFEAMLCTPIVCATRVIGVINLQHRLSYSHSSVEVRLLSLIGYLVGA
EIERARLDTENLQLADRLETRKAIDRAKGLLQRDLSISESDAYRMMQRESRQRRKTMREI
AEALLLNEEMKRSTSVA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgcaagctttgacggtctgcgggttctttcactcgaatccagacgggccaaa
gaggtagagaagctcatccgcacctatggcggacagcccttcgtcgtgcctttcatgcga
gaggtgaagctcgaatcgaaccatgccgcgctggactttgcggaccgcctcatgcgcggc
gaactcgatgtcgtcatctttatgaccggtgttggagttcgggctctgctggaaattgtc
gagacacgctattctcgaacggaatttctcgaagccttgggaagaataaaaattgtgacg
cgaggctcgaaaccagaagccgcattacgcgaactaaagctccgctcggtcgcaaccgcg
tccgagcccacaacctggcatgagctcatgtccgccatgcacgcctactttggcgactcg
ctcaaggaccaacgcattgccctgcaggagtacggagcgtccaacccggaactcctcgcg
gaattgaccgagtgcagcgcctccgtcttcaaggtgccggtgtatcaatgggcgctgccg
cacgatctcaaaccactgcgcgagtgcgtccacggcctcacccacgccagtgtggatgtt
gtgctctttacgaccgcagtccaggtcatccacctcatgctgatcgcgcaggagatgaac
caggtcgccgagatgctcgctggtctacgttccgtcgtggtggtctcggtaggccccacg
acaaccgccgagctcctgcattacggcattcccccggacttcgagccctctcgccccaaa
atgggcttcctcatcaacgaggccgcgcagtactccgcccaggtgctgcagggcaaacgc
cagcgagcgtcgctgccgcccgaagaggagtttgagccggcccctgcccccggcgaacca
ctcacccatgtcgcccaatcccgccatgcagtccgccgcgtagccgagtcgactcccacc
atggccggcttcagcgacggcctcagctcctttgacttcctgcatgagatatcccgccgc
ctcgccgcctccgaccccctccacaccgtgctcgaccgcatcctcgagttcgtcaccacg
atgattccctgcgactcctgtttcctctacaccctcgaaggagagaagctggttctccgt
gcttccagaaaccctcacgcagatatcgtcgactcgctcggcatcaagctggggcagggg
atcacgggctgggtcgccgaacaccgcgagccagtcgcaatcgcctccagagcctcggaa
gatccgcgcttttcgaaattcaagaacattccggaggacaccttcgaggccatgctatgt
acgcccatcgtctgcgcgaccagggtcatcggcgtcatcaacctgcagcatcgcctgtcc
tacagtcacagcagtgtggaagtccggttgctctccctgatcggctatcttgtaggcgct
gaaattgaacgcgcccggctggacaccgaaaacctgcaattggctgatcggcttgagacg
cggaaagcgattgaccgcgccaagggattgctgcaaagggacctgagcatctctgaaagc
gacgcataccgcatgatgcagcgcgaaagtcgacagagaaggaagaccatgcgtgaaata
gccgaggctcttctgctaaacgaagagatgaagcgctccacatcggtcgcttag

DBGET integrated database retrieval system