KEGG   Granulicella tundricola: AciX9_0136Help
Entry
AciX9_0136        CDS       T01411                                 

Definition
carboxymuconolactone decarboxylase
Orthology
K01607  
4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
acm  Granulicella tundricola
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AciX9_0136
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AciX9_0136
Enzymes [BR:acm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     AciX9_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
154540..154953
Genome map
AA seq 137 aa AA seqDB search
MANELTPSATDTLYKLGSETFTSSLGTSAAEFEKGFEDIAPGFGRLILEAEFGTAYHRPG
LDLKTRELIIVATCATLGATGYGAAKMHIGAALRAGATRAEIVEALVQITFAAGLPTSIG
ALEAARDAFAALDKEGR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaactcactccctccgcaacggacaccctctacaaacttggttccgaaacc
tttacgtcttcgctcggcacgtctgcggccgaatttgaaaaaggcttcgaggacattgcg
cctggattcggccgactcattctggaagcagagttcggtacggcctatcaccgtcccggt
ctcgatctgaagacgcgcgaactcatcatcgtcgcgacttgcgcaactcttggcgccacg
ggatacggtgcggccaagatgcatatcggagcggcgcttcgggcaggtgcaacccgtgca
gagatcgtcgaagcgctcgtgcaaattaccttcgctgcgggtcttcccacttctatcggt
gcccttgaggcggcgcgtgatgcattcgccgccctcgacaaggaaggccgctaa

DBGET integrated database retrieval system