KEGG   Granulicella tundricola: AciX9_0295Help
Entry
AciX9_0295        CDS       T01411                                 

Definition
(GenBank) Cellulase
Organism
acm  Granulicella tundricola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
358411..359556
Genome map
AA seq 381 aa AA seqDB search
MKTFAALALLLAASLASAQQPDRTLTLLQRLADAPGPPGAEEAVRAIMVPEMKPFITEPL
RYDGTGSVIAQQGTKGPRIMIDAHMDELGGMVRRVTPNGFLTMQMLGGWLDQALVDQRWI
IIGSKGPVHAVTGIRDIHIVPAEERTRVFSRDSLYLDVGAKNAQEVFAMGVEAGDPVVPD
SPFTVMNGTQNYLGKGWDDRIGCAVLLEAMRRTSAMPHPNQLFYVATTQEEVGLRGAKAA
SQLVKPDIGIAIEGGITGDTAGAHPEESQVKLGAGPGMFLYDSSTIPNRKLVAFTRAAAR
SASLPLQADLVQGYGDDSAEMQASSGGTPTINLVVPVRYTHSHNGIVNRQDFDRTVDLVV
AMLMKLDAAAVADLRDFTPKP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttttgccgcgctggccctcctcctcgcagcttctctcgcctcagcccagcag
ccagaccgcaccctcaccctcctccagcgcctcgccgacgcccccggacctcccggcgca
gaggaagccgtccgcgccatcatggtccctgagatgaagcccttcatcaccgagcccctc
cgctacgacggcaccggctcggtcatcgcgcagcagggaaccaagggcccccgcatcatg
atcgacgcccacatggacgagctcggcggcatggtccgccgcgtcacccccaacggcttc
ctcaccatgcagatgctcggcggctggctggaccaggctctcgtcgaccagcgctggatt
atcatcggctccaagggccccgtccacgccgtcaccggcatccgagacattcacatcgtt
cccgccgaagagcgcacccgcgtcttctcccgcgactccctctacctcgacgttggtgcc
aagaacgcccaggaggtcttcgccatgggcgttgaggccggtgacccggtcgtccccgac
tcgcccttcaccgtcatgaacggcactcagaactacctcggcaaaggctgggacgaccgc
atcggctgcgctgttctcctcgaagccatgcgccgcacctccgccatgccgcaccccaac
cagctcttctacgtcgccaccacgcaggaggaggtaggccttcgcggtgccaaggcagcc
tcccagctcgtcaagccggacatcggcatcgccatagaaggcggcatcaccggcgacacc
gccggagcccacccggaggagtcccaggtcaaactcggcgcaggccccggcatgttcctc
tacgactccagcaccatccccaatcgcaagctcgtagccttcacccgagccgcggccaga
tccgccagccttccccttcaggcagacctcgtccagggctacggagacgactccgccgag
atgcaggcctccagcggtggcacccccaccatcaacctcgtcgtccccgtccggtacacc
cactcccacaacggcatcgtcaaccgccaggacttcgatcgcaccgtagacctcgtcgtc
gccatgctcatgaagctggacgccgccgccgtcgccgacctgcgcgacttcacccccaaa
ccctaa

DBGET integrated database retrieval system