KEGG   Granulicella tundricola: AciX9_0295Help
Entry
AciX9_0295        CDS       T01411                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
acm  Granulicella tundricola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX9_0295
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AciX9_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
358411..359556
Genome map
AA seq 381 aa AA seqDB search
MKTFAALALLLAASLASAQQPDRTLTLLQRLADAPGPPGAEEAVRAIMVPEMKPFITEPL
RYDGTGSVIAQQGTKGPRIMIDAHMDELGGMVRRVTPNGFLTMQMLGGWLDQALVDQRWI
IIGSKGPVHAVTGIRDIHIVPAEERTRVFSRDSLYLDVGAKNAQEVFAMGVEAGDPVVPD
SPFTVMNGTQNYLGKGWDDRIGCAVLLEAMRRTSAMPHPNQLFYVATTQEEVGLRGAKAA
SQLVKPDIGIAIEGGITGDTAGAHPEESQVKLGAGPGMFLYDSSTIPNRKLVAFTRAAAR
SASLPLQADLVQGYGDDSAEMQASSGGTPTINLVVPVRYTHSHNGIVNRQDFDRTVDLVV
AMLMKLDAAAVADLRDFTPKP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttttgccgcgctggccctcctcctcgcagcttctctcgcctcagcccagcag
ccagaccgcaccctcaccctcctccagcgcctcgccgacgcccccggacctcccggcgca
gaggaagccgtccgcgccatcatggtccctgagatgaagcccttcatcaccgagcccctc
cgctacgacggcaccggctcggtcatcgcgcagcagggaaccaagggcccccgcatcatg
atcgacgcccacatggacgagctcggcggcatggtccgccgcgtcacccccaacggcttc
ctcaccatgcagatgctcggcggctggctggaccaggctctcgtcgaccagcgctggatt
atcatcggctccaagggccccgtccacgccgtcaccggcatccgagacattcacatcgtt
cccgccgaagagcgcacccgcgtcttctcccgcgactccctctacctcgacgttggtgcc
aagaacgcccaggaggtcttcgccatgggcgttgaggccggtgacccggtcgtccccgac
tcgcccttcaccgtcatgaacggcactcagaactacctcggcaaaggctgggacgaccgc
atcggctgcgctgttctcctcgaagccatgcgccgcacctccgccatgccgcaccccaac
cagctcttctacgtcgccaccacgcaggaggaggtaggccttcgcggtgccaaggcagcc
tcccagctcgtcaagccggacatcggcatcgccatagaaggcggcatcaccggcgacacc
gccggagcccacccggaggagtcccaggtcaaactcggcgcaggccccggcatgttcctc
tacgactccagcaccatccccaatcgcaagctcgtagccttcacccgagccgcggccaga
tccgccagccttccccttcaggcagacctcgtccagggctacggagacgactccgccgag
atgcaggcctccagcggtggcacccccaccatcaacctcgtcgtccccgtccggtacacc
cactcccacaacggcatcgtcaaccgccaggacttcgatcgcaccgtagacctcgtcgtc
gccatgctcatgaagctggacgccgccgccgtcgccgacctgcgcgacttcacccccaaa
ccctaa

DBGET integrated database retrieval system