KEGG   Granulicella tundricola: AciX9_0318Help
Entry
AciX9_0318        CDS       T01411                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acm  Granulicella tundricola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AciX9_0318
Enzymes [BR:acm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AciX9_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
390224..391354
Genome map
AA seq 376 aa AA seqDB search
MPTHVRSYSKINLGLAIGPPRSDGFHSLVTLYQTLALYDQIALVARPAAVTRITLRSNDP
RVPLDARNTVWKMVAKALSVLNRTAEVTVHIQKNLPIQGGMGAGSANAAAALIGLEKALC
LSIPPETRLEIAAQVGSDVPLFLVGGASFGSNRGEAVTPAPVITFEGQSEIPCVIALPNV
GVSTPQAFRDWDARFKSAPDLHNPPIRDTMNELSRTYASVFGYQGEMESNQSGASGIFPE
PSLSVASGSPEKLQGTPDEQLHRSPETTDRSGIKIDLAENSLLALVRTGIENDFETVVFP
QYPSLREIKRHLMGPSEQENSAIIAALSGSGSALFGLYRSKSHAEAAQQRLQQHGVKALV
TTTLPRPLYWSDMFAE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccaacccacgtccgctcttattcgaagatcaacctcggcctcgccatcggcccaccg
cgctctgacggcttccactccctcgtcaccctctatcagaccctggcgctctacgaccag
atcgctctggtagcccgccccgccgccgtcacccgcatcaccctccgctccaacgatccg
cgcgtccccctcgacgcccgcaatacggtctggaagatggtcgccaaggccttgtcggtc
ctcaaccgcactgcggaagtcaccgtccacatccagaaaaatcttcctattcagggcggc
atgggagcgggttcagccaacgccgccgccgccctcatcggccttgaaaaggctctctgc
ctctctatcccgcccgaaactcgcctcgagatcgccgcccaggtcggctcggacgtccca
cttttcctggtcggcggcgcctccttcggctccaatcgtggcgaagccgtcacccccgcc
cccgtaatcacctttgagggccagtccgagattccctgtgtcatcgccctcccgaacgtc
ggcgtctccaccccccaggccttccgcgactgggacgcacggttcaaatccgcacccgat
ttgcacaatccgcccattcgcgatacgatgaatgagttgagccgcacttacgcgtccgtc
ttcggctaccaaggcgaaatggaaagcaatcagtctggcgcctccggtatctttcctgaa
ccgagtctgagcgtagcctcaggcagccctgagaaattgcagggaactccagatgagcaa
cttcatcgcagtcctgaaactacggacaggagcggaatcaagattgatctggccgagaac
tcccttctcgcgcttgtccgcaccgggatagaaaacgactttgaaacggtcgtctttcct
cagtatccctccctgcgtgaaatcaagcgacatttgatgggaccttcggaacaagagaac
tccgcaatcattgcggcgctctcgggctcaggctctgccctcttcggcctttaccggtcc
aagtcgcacgcagaagccgctcaacaaaggctccagcagcacggcgtcaaggcacttgtc
acgacgactctgccacgccctctctactggagtgacatgttcgcagagtaa

DBGET integrated database retrieval system