KEGG   Granulicella tundricola: AciX9_0430Help
Entry
AciX9_0430        CDS       T01411                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
acm  Granulicella tundricola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX9_0430
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AciX9_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
511659..514139
Genome map
AA seq 826 aa AA seqDB search
MNEKASDYRWLDDDGAAFGSPGVEPRWTSSKKDAVSTAYSASSRVWFTVSHGTLNEVYYP
TIDRPQMRDMELLFTDEETFFHEEKRDFEYDFHYVDPGAPAVRVVASDLDGRYTVTKEFI
ADPHHPVVLMNVKIAGDEAVVSRLKCYVLLAPHLDGGGAGNSARSLSVAGRRTLLAWKGE
HNSLAVGADCGFTRSSCGYVGTSDGYQDLSTHMKMQWQFGQALNGNVAVTGEIDVARNRE
FTIAIAFGDGHHAALSGMMQTLSTPYAEHAKRFIDQWHRAESPAALAKASTDGGRLMRVS
HNVILTHEDKTYSGAFIASASIPWGASKGDDDLGGYHLVWTRDMVQSATALLACGRTETA
RRALVYLACTQRPDGGFAQNFWIDGSAYWTGIQLDEVAFPIILAWRLWKVDGLGVFDVFP
FVEKAAAFLVRYAPVTQQERWEENAGYSPSTLAAVISGLVCAADIARAYQASELAGFLET
YADWIESHLDEWTTTEDGMLLDGVKRHYMRIRPPAEGEPFHNPGVKPGFIRLANRGPEEE
SEFDAREVVDGGFLELVRYGIRRADDPLMVESLKVVDACLKYETPYGPCWRRYNHDGYGQ
KKDGGPYDGFGQGRAWPLLGGERAHYELAAGHDVKPFITAYEKFSSIGGMLPEQVWDHDD
MPEEGLYLGRSAGSAQPLVWAHAEYVKLLRSVSDGKVFDTISVVAERYAVEPGTRTFQNT
VEIFQTARPFATIPTGFTLRVVDRARFRMSYTLDGWATTTTVDSRVVGYPGSFADVVMPG
EPGELEFTLFWPTTADAPEHWLGHNYKVAVTSQGPETMPAGAKPQS
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagcttcggattatcgctggctggatgatgacggggcggcctttgggtcg
ccgggtgtggaaccgcgctggacttcgagcaagaaggacgcggtgtcgacggcttactcg
gcatcaagccgggtgtggtttacggtgtcgcacgggacgttgaacgaggtgtactacccg
acgatcgatcgtccacagatgcgcgatatggagcttctgtttacggacgaggagacgttt
ttccacgaggagaaacgggatttcgagtacgacttccactacgtggacccgggtgctccg
gcggtgagggtggtggcttctgacctggatgggcggtatacggtcacgaaggagtttatt
gccgatccgcatcatccggtggtgctgatgaatgtgaagatcgccggggatgaggcggtg
gtctcccggctgaagtgctatgtgctgctggctccgcacctggatgggggtggcgcgggg
aactcggcacgatcgctttccgtggctgggcgtcggacgctgctggcgtggaagggcgag
cacaactcgctggcggtgggggcggactgcgggtttacgcggagctcgtgcgggtatgtg
gggacgagcgatgggtaccaggacctgtccacgcatatgaagatgcagtggcagtttggg
caggcgctgaatgggaatgtggcggtgacgggcgagatcgacgtggcgcggaaccgggag
ttcacgattgcgattgcgttcggcgatgggcaccatgcggcgctgtccgggatgatgcag
acgctctccacgccttatgccgaacatgcgaaacggtttatcgaccagtggcatcgggct
gagtcgccggcggcgctggccaaggcttccaccgacggcgggcggctgatgcgggtgagc
cataacgtcatcctgacgcatgaggataagacgtactcgggcgcgtttattgcttcggct
tcgattccgtggggggcctcgaagggggatgacgatctgggtgggtatcacctggtttgg
actcgggatatggtgcagtcggcgacggctttgctggcttgcgggagaacggagaccgct
cgacgggcactggtttacctggcttgtacgcagcggccggatggcgggtttgcgcagaac
ttctggatcgatgggtcggcttactggaccgggattcagttggatgaggtggcgtttccg
atcatcctggcgtggcggctctggaaggtggatgggctgggggtgttcgacgtcttcccg
tttgtggagaaggcggcggcgttcctggtgcggtatgcgccggtgacccagcaggagcgt
tgggaggagaatgcggggtactcgccttctacgctggcggcggttatctcagggctggtt
tgtgcggcggatatcgcacgggcttatcaggcttctgagttggctgggtttctggagacc
tatgcggactggattgaatcgcatctggacgagtggacgacgaccgaagacgggatgctg
ctggatggagtgaagcggcactatatgcggattcgtccgccggctgagggcgagccgttc
cataatccgggggtgaagcctgggtttatccggctggcgaaccgtgggccggaggaggag
tcggagttcgacgcgcgggaggttgtggacggcggattcctggagctggtgcggtacggg
attcggcgagctgacgatccgctgatggtggagtcgctgaaggttgttgacgcttgtttg
aagtatgagacgccctacgggccttgctggcggaggtacaaccacgacggctatgggcag
aagaaggatggcggcccttacgacgggtttgggcagggcagggcgtggcctctgctgggc
ggcgaacgggcgcactatgagctcgctgcgggccatgatgtgaagccgtttattacggcg
tatgagaagttttcttcgatcggcgggatgctgccggagcaggtctgggatcacgacgat
atgccggaggaagggctgtacctggggcggtcggcggggtctgcgcagcctctggtgtgg
gcccatgcggagtatgtgaagctgctgcggtcggtttcggatgggaaggtgttcgatacg
atttccgtggtggcggagcggtatgcggtcgagccagggacgcggacgttccagaacacg
gtggagatcttccagacggcgcggccttttgcgacgattccgacagggtttacgctgcgg
gttgtggatcgggcacggttccggatgagctatacgctggacggctgggctacgacgacg
acggtggactcgcgggtagttggatatccgggatcgtttgcggatgtggtgatgccgggc
gagccgggggagctggagtttacgttgttctggccgacgacggcggacgccccggagcac
tggctggggcataactataaggtggcggtgacgtcgcaggggccggagacgatgcctgcg
ggggctaagccgcagtcgtag

DBGET integrated database retrieval system