KEGG   Granulicella tundricola: AciX9_0439Help
Entry
AciX9_0439        CDS       T01411                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acm  Granulicella tundricola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX9_0439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_0439
   00052 Galactose metabolism
    AciX9_0439
   00500 Starch and sucrose metabolism
    AciX9_0439
   00520 Amino sugar and nucleotide sugar metabolism
    AciX9_0439
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AciX9_0439
   00524 Butirosin and neomycin biosynthesis
    AciX9_0439
Enzymes [BR:acm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AciX9_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
522195..523244
Genome map
AA seq 349 aa AA seqDB search
MILAGDVGGTKVHLALYNFVGGQPKLIRDQKYPATEFGSLDEVVHAFLAVDGDKAAAEVK
DVVAACFGCPGPVRDGRIKLTNLPWSLDVRDLRKSLGIEHIFLVNDLEANGYGIAELAPS
AIFTLHPGDVTAIGHRGLIAAGTGLGEALLVWDGKKHQPLPSEGGHTDYAPRTDQDIRLL
QYLRKTLKGRVSFERVVSGIGIKNVYAFLRDEEGMEEPAWLKERMEKEDPNAVIGTCAED
GSSEICYETMQIFAAAYGAETGNIALKVLAAGGMYLGGGVAPKILKTLQSGKFMEAYLDK
GRLSPVLEAIPVRVILDDTCALLGAAAYAESRASELTGHSERVASYHAG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattctggctggtgatgtcggtgggaccaaggttcatctggcgctgtataactttgtc
ggcggtcagccgaagctgattcgcgaccagaagtatccggcgacggagttcgggtcgctg
gatgaggtggtgcatgctttcctggcggtggatggggataaggcggccgccgaggtcaag
gacgttgtggcggcttgctttgggtgcccggggccggtgcgggatgggcggatcaagctg
acgaacctgccctggtcgctggatgtaagggacctgcggaagtcgctggggatcgagcat
atttttctggtcaacgatctcgaggcgaacgggtacggcatcgccgagcttgcgccgagc
gcgatctttacgctgcatccgggggatgtgacggcgatcgggcatcgtgggctgattgcc
gcagggaccgggctgggcgaggcgctgctggtgtgggacggcaagaagcatcagccgctg
ccttcagagggcgggcatacggactatgcgccgaggacggatcaggatattcggctgctg
cagtatctgcggaagacgctgaagggacgggtttcgtttgagcgggtggtgtcggggatt
gggatcaagaatgtgtatgcgttcctgcgggatgaggagggcatggaagagccggcgtgg
ctgaaggaacggatggagaaggaagatccgaatgcggtgatcggcacgtgtgcggaggat
gggtccagcgagatctgctatgagacgatgcagatctttgcggcggcttatggggctgag
acggggaatatcgcgttgaaggtgctggctgcgggtgggatgtacctggggggtggcgtt
gcgccaaagattttgaagacgctgcagagtgggaagttcatggaggcttacctggataag
gggcggctgtctccggtgctggaggcgattccggtaagggtgattctggatgatacttgt
gcgcttctgggggcggctgcttatgcggagagtcgggcttctgaacttaccgggcactct
gagcgggtggcttcttatcatgcggggtag

DBGET integrated database retrieval system