KEGG   Granulicella tundricola: AciX9_0663Help
Entry
AciX9_0663        CDS       T01411                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acm  Granulicella tundricola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX9_0663
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX9_0663
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciX9_0663
Enzymes [BR:acm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciX9_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
804233..804997
Genome map
AA seq 254 aa AA seqDB search
MPIDFLKKPGVVAYLTAGDPDLATTRDIALAAIDAGADVIELGVPFSDPLADGPVIQRAS
ERAVARGTRLSDVLGLAKELRAARPECGIVLFSYLNPVVKMGMRSFCAAAKAAGADGVLL
TDMIVEEAGEYLAEMSTNGLAPVFLAAPTSPDARLKAIGEASKGFVYAISRVGITGTQDK
VASDAPELVARLRKYTELPIAVGFGISNAAHVKAVGEFADAAIIGSALVALIEKTGPADA
AKAVGEFIRGLREG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagattttctcaagaagcccggtgttgtcgcttatctcactgcgggtgatccg
gatttggctactacgcgggatattgcgttagctgctattgatgccggtgcggatgtgatt
gagcttggcgtgccgttcagcgatcctctggcggatgggccggtgattcagcgggcgagt
gagcgggctgtggcgcgggggactcggctgagcgatgtgctggggctggctaaggagctt
cgggctgctcgaccggagtgtgggattgtgctgttcagctatctgaatcccgtggtgaag
atggggatgaggtctttctgtgcagccgcgaaagctgccggtgcggatggcgtgctgctg
acggacatgattgtcgaagaggctggggaatacctggcggagatgagtacgaatgggctg
gcgccggtgtttctggcggcgcctacgagcccggatgctcggctgaaggcgattggcgag
gcgagcaaagggtttgtgtacgcgatctctcgcgtggggattacggggacacaggataag
gtggcgagcgatgcgccggagcttgtggctcggctgcggaagtatacggagctgccgatt
gcggtcggctttgggatctcgaatgcggcgcacgtgaaggctgtgggcgagtttgcggat
gcggccattatcggcagtgcgctggtggctttgatcgagaagacggggcctgcggatgca
gcgaaagcagtcggcgagttcattcgtgggcttcgtgaagggtaa

DBGET integrated database retrieval system