KEGG   Granulicella tundricola: AciX9_0982Help
Entry
AciX9_0982        CDS       T01411                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
acm  Granulicella tundricola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AciX9_0982
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AciX9_0982
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AciX9_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1161211..1161762)
Genome map
AA seq 183 aa AA seqDB search
MSTLFEIPLKTLSGEDSNLAPYAGHVLLIVNTASKCGLTPQYEGLEQLYSTYKDRGFDVL
GFPANDFAGQEPGTAQEIQKFCTLSYNVTFPMFDKTVVTGAEKSPLYTQLIAAQPVARVA
DPKFKDNLRGYGLTVNEEPELTWNFEKFLVNRKGEVVARFAPDTLPTDDAVIQAIERELT
AQA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactctctttgaaattcctctcaagactctctccggtgaagactccaaccttgcg
ccttacgcgggccacgtcctgctcatcgtcaacactgcgtccaagtgcggcctgaccccg
cagtatgagggcctcgagcagctgtactccacgtacaaggatcgcggcttcgacgtactg
ggctttccggccaacgactttgccggccaggagccggggaccgcgcaggagatccagaag
ttctgcacgctctcctacaacgtgacctttccgatgttcgataagactgtcgtcaccggc
gcggagaagagcccgctctacacgcagctgatcgcggcccagccggtcgcgcgtgttgcc
gatcccaagttcaaggataatctccgcggctacggtctcacggtgaatgaagagccagag
ctgacctggaacttcgagaagttcctggtcaaccgcaagggcgaggtcgtcgcacgcttt
gcgccggatacgcttcccaccgatgatgccgtgatccaggcgatcgagcgcgagctcacc
gcacaggcatag

DBGET integrated database retrieval system