KEGG   Granulicella tundricola: AciX9_1076Help
Entry
AciX9_1076        CDS       T01411                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
acm  Granulicella tundricola
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AciX9_1076
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AciX9_1076
Enzymes [BR:acm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AciX9_1076
Two-component system [BR:acm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AciX9_1076
Bacterial motility proteins [BR:acm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AciX9_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1255536..1256210
Genome map
AA seq 224 aa AA seqDB search
MKISAGDGRKTPGALEIVVIGVSTGGPSALEVMLPGLPKDFPAPVLVVQHMPRLFTGSLA
ERLDRLCPLRVREASGGVEVKAGTIWITPGDAHMEIARGFNGLTVSLHQQAMLNSCRSSV
DYLFRSAAEVVGAGTVAVVMTGMGADGLEGARAVRHAGGRVLVQDEASSAVWGMPGRVMQ
AGLAEAALGLDELAAGLMKRVVGQGQEEASVVSVERRQERFYGS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctcggcgggagatgggaggaagactccgggtgctttggagatcgtggtgatt
ggcgtatcgactggcgggccttctgcgctggaggtgatgcttccgggtctgccgaaggat
tttcctgcgccggtgttggtggtgcagcatatgccgaggctgtttacaggctcgctggcg
gagaggctggaccggctttgtcctctgcgggtgcgggaggcgagcggtggcgttgaggtg
aaggcggggacgatctggattacgccgggggatgcgcatatggagattgcgcgtggattc
aatgggcttacggtgtcgctgcaccagcaggcgatgttgaactcctgcaggtcctctgtg
gactatctgtttcggtctgcggctgaggtggtgggcgcagggacggttgcggtggtgatg
acgggcatgggcgcggatgggctggagggtgcgcgtgcggtgcgacatgcgggtgggagg
gtgctggtgcaggatgaggcgagctccgcagtgtgggggatgccggggcgggtgatgcag
gcgggactggcagaggctgcgctggggctggacgagttggctgcgggtctgatgaagcgg
gttgtgggtcaaggacaggaagaggcgtcggtcgtatcggtcgagcgccggcaggagagg
ttttatggcagttag

DBGET integrated database retrieval system