KEGG   Granulicella tundricola: AciX9_1096Help
Entry
AciX9_1096        CDS       T01411                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
acm  Granulicella tundricola
Pathway
acm00900  Terpenoid backbone biosynthesis
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AciX9_1096
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AciX9_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADW68159
UniProt: E8X3G8
Position
complement(1280411..1281616)
Genome map
AA seq 401 aa AA seqDB search
MASYTGCTCDKATPHVKKIAILGSTGSIGTSTLSICEQFPLRYTPIALAAGSNIEVAFAQ
AKQWRPKLISIATEPLADALKLRLRTEGITGIEVLSGIPGTIAVATHPEVEFVVSAIVGV
AGLEATYAAVQAGKTIGLANKECLVAAGDLIISAARAKNVALLPIDSEHNAVHQAMRGGT
PAEVKQIWLTASGGPFRNTPLEQFQHITPHQALKHPTWVMGQRITIDSATMMNKGFEVIE
ACRLFDLPAAKVRVTVHPQSTVHSLVEFIDGSILAQISVTDMRLPILYALAYPERPASNL
TFDLAQLSQLDFSQPDLAKFPCLRLAYEAADAGPSACIALNAADEIAVAAFLAGHIPFLG
IPRTIERVLELTPAANPTSIQGVLAADQAARTCAREVIARA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcgtacacgggctgtacgtgcgataaggctacccctcacgtgaagaagatagca
atcctaggcagcaccggttccatcggaacctccaccctctccatctgcgagcagttcccc
ctccgctacacccccatagccctcgccgcaggctcaaacatagaagtagccttcgcccaa
gcgaagcagtggcgtccaaagctcatctccatagccacggagccactcgcagacgcctta
aagctccgcctccgcacagagggcatcaccggcatagaagtcctctccggcatccccggc
accatcgccgtggccacccatccagaggtcgagttcgtagtttccgccatcgtaggcgta
gccggtctggaagccacctacgcagcagtccaggccggaaaaaccataggcctggcaaac
aaagagtgcctggtagccgccggcgacctcatcatctcagcagcccgcgcaaaaaacgta
gccctcctccccatagactccgagcacaacgccgtccaccaggccatgcgcggaggaacc
cccgccgaagtcaagcaaatctggctcacagcctccggtggccccttccgcaacaccccg
ctagagcagttccagcacatcaccccgcatcaagccctaaagcacccaacctgggtcatg
ggccagcgcatcaccatcgacagcgccaccatgatgaacaagggtttcgaggtcatcgaa
gcctgccgcctcttcgacctccccgccgccaaggtccgcgtcaccgtccacccccagtcc
accgtccactccctcgtggaattcatagacggcagcatcctggcccagatctccgtcacc
gacatgcgcctccccatcctctacgccctcgcctaccccgagcgtccagcctcaaacctc
accttcgacctcgcccagctctcccaactcgacttctcccagcccgatctcgccaaattc
ccctgcctccgcctcgcctacgaagccgccgacgccggcccctccgcctgcatcgccctc
aacgccgctgacgagatcgctgtagccgccttcctcgccggccatatccctttcctcggc
atcccacgtacaatcgagcgtgtcctggagctcaccccagcggctaaccccacgtctatt
caaggggttctcgccgccgaccaggccgcccgcacctgcgcacgcgaagtcatagcccgc
gcatag

DBGET integrated database retrieval system