KEGG   Granulicella tundricola: AciX9_1170Help
Entry
AciX9_1170        CDS       T01411                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
acm  Granulicella tundricola
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:acm00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:acm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373711..1374709
Genome map
AA seq 332 aa AA seqDB search
MKVGVVALMMGFTLGGWGQGLKTITVGPAGSRADFATVQEAVTAAPETGAVIRIRPGIYR
EVVHVDKANIQMRGETKDASTVVIVDDMGDPKTCGTFCSPTMFVTGDGFVASNLTISNDL
SKTGKPRTQGVALSITGDRAVLRNVRLLGAQDTLYAASRKCAAGAECKASRQYYDHCYIE
GEVDFIFGNAKAVFHDCEIHSVVHEAGGYLTAQSRNSVAEDSGYVFDHCRVTAEPGVSKV
YLGRPWRDYATVTFLNTELRAHIAPAGWSEWHQGETDRLKTASYAEYRSTGPGANVAERE
PLSKQLTADEAKGYEVKKYLAGSDGWDAAAVK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttggagttgtggcgttgatgatggggttcaccctgggcggatgggggcagggg
ctgaagacgattacggtggggccggcggggtccagggctgactttgcgacggtgcaggag
gcggtgactgcggctccggagactggggcggtgattcggattcggccggggatctaccgg
gaggtggtgcatgtggacaaggcgaatatccagatgcgcggggagacgaaggacgcctcg
accgtggtgatcgtggacgatatgggagatccgaagacgtgtgggacgttttgttccccg
acgatgtttgtgacaggggatgggtttgtggcttccaatctgacgatctccaacgacctg
agcaagacggggaagccgaggacgcagggggtggcgctttcgatcacgggggatcgggcg
gtgctgcggaatgttcggctgctgggggcgcaggatactttgtatgcggcgagcaggaag
tgtgcggctggggcggagtgcaaggcgtcgcgacagtactacgaccattgctatatcgaa
ggggaggtggacttcatcttcgggaatgcgaaggcggtgtttcatgactgcgagatccat
agcgtggtgcatgaggcgggtggatatctgacggcacagtcgaggaactcggtggcggag
gactcgggatatgtgttcgatcattgccgggtgactgcggagccgggggtgtcgaaggtg
tacctgggacggccgtggcgggattatgcgacggtgacgtttctgaatacggagttgagg
gcgcatatcgctccggcgggctggtctgagtggcatcagggtgagacggatcggctgaag
acggcctcttatgcggagtatcggtctactggtccgggagcgaatgtggcggagcgggag
ccgctttccaaacagcttacggcggatgaggcgaagggatatgaggtgaagaagtatctg
gccgggagcgatgggtgggatgccgcggcggtgaaatga

DBGET integrated database retrieval system