KEGG   Granulicella tundricola: AciX9_1216Help
Entry
AciX9_1216        CDS       T01411                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acm  Granulicella tundricola
Pathway
acm00051  Fructose and mannose metabolism
acm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AciX9_1216
Enzymes [BR:acm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AciX9_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADW68279
UniProt: E8X4F2
Position
complement(1436508..1437269)
Genome map
AA seq 253 aa AA seqDB search
MHDRNNAPAESECRTEAQLRQELVRFGKWVHRLGFTPGTSGNLSVRLDRQRLLVTPTGVS
KCLLKPADMVIVDLRGRLLEGTRKVTSEIGMHLAVYDQRPDVQAVIHSHPPIATAFACAG
RALSEMLCQEAVMTLGIVPLARYATTGTCEVAESLAPYLPAHDAILLANHGAVSYGLTLL
EAFQKMETLEHLAQVSLVAHQLGTAQPLTAQQIEQLHLARSKYLHNAAQTNEPDSLPHRT
QQHETELFVVESR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaggaacaacgccccggcggagagtgagtgtaggactgaagcacagttgcgc
caggagctggtccgtttcggcaagtgggtccaccggctcggcttcaccccaggaacctcc
ggcaacctctccgtgcgcctcgatcgccagcgccttctcgtcacccccactggcgtcagc
aaatgcctcctcaagccggccgatatggtcatcgtcgatcttcgcggccggctcctcgaa
ggcacacgcaaggtcaccagtgagattggcatgcatctcgccgtctacgaccagcgcccc
gacgtccaggccgtcatccactcccacccacccatcgccacggccttcgcctgcgcaggc
cgcgccctcagcgagatgctctgccaggaagccgttatgacccttggcatcgtccccctc
gcacgctacgccaccaccggcacctgtgaggtcgcggagagcctcgcgccttaccttccg
gcccacgatgccatcctgctcgccaaccacggtgccgtcagctacggcctcaccctgctc
gaagccttccagaagatggagacccttgagcatctcgcccaggtcagcctggtcgcccac
cagctaggcaccgcccaacccctcaccgcccagcagatcgagcagctccacctggcccgc
tccaagtatctccacaacgcagcccaaaccaacgagcccgactccctcccccaccgcacc
cagcagcacgaaacagaactattcgtcgtggaaagccgttaa

DBGET integrated database retrieval system