KEGG   Granulicella tundricola: AciX9_1595Help
Entry
AciX9_1595        CDS       T01411                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
acm  Granulicella tundricola
Brite
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     AciX9_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1848312..1849331
Genome map
AA seq 339 aa AA seqDB search
MKVFITGATGFVGAHVARAYAAQGASLRLLTRSSSNLAGIEGLEAETVVGDLRQVEGLRV
ALTGCDALVHVAADYRLWVRDPEEMMAANVGGTRELLRVAREVGVPKVVYTSSVATMGFL
TDGTIVDEATPVSVEAMIGVYKRSKYLAELEAIAAAKAGQHVMILNPTTPIGPGDRKPTP
TGGILVDFLNRKFPAYVDTGLNLVDVGEVARMHVVALERGTPGERYILGGENLTLKQILD
RLSTITGLPSPTIKVPHAVAMAFAFFDENFTGRLLGKEPRATVEAVRMGKKMMFASSAKA
ERELGFKVVPVYGAMRAAVEWFLANGYAPALKADVGRAV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttatcactggtgcgacggggtttgtgggggctcatgtcgcgcgggcgtat
gcggcgcagggtgcttctctgcgtctgctgactcgctcatccagcaatctggccgggatt
gaagggcttgaggcggagaccgtggttggggatctgcggcaggttgaggggctgcgagtt
gcgctgacggggtgcgatgcgctggtgcatgtggcggcggattatcggctttgggtgcgt
gatcctgaagagatgatggcggcgaatgtgggggggacgcgggagctgctaagggtggct
cgcgaggtgggggtgccgaaggtggtttatacctcctccgttgcgacgatgggctttctg
accgatgggacgattgtggatgaggctacgccggtgtccgttgaggcgatgattggggtt
tacaagcggtccaaatacctggcggagctggaggcgattgcggcggcgaaggcggggcag
catgtgatgattctgaatccgacgacgccgattgggccgggggatcggaagcctacgcct
acgggcgggattctggtggactttctgaaccgcaagtttccggcttatgtagatacgggg
ctgaacctggtggatgtgggtgaggtggctcggatgcatgtggtggcactggagcggggg
acgccgggggagaggtacatcctgggtggggagaacctgacgctgaagcagattctggat
cggctttctacgattacggggctgccttcgccgacgatcaaggtgcctcatgcggtggcg
atggcgtttgcgttcttcgacgagaactttacggggcgcctgcttgggaaggagcccaga
gctacggttgaggcggtgcggatgggaaagaagatgatgtttgcgagctcggccaaggcg
gagcgtgagcttggattcaaggtggtgccggtgtatggggcgatgcgggcggcggtggaa
tggtttctggcgaatgggtatgcgccggcgctgaaggcagacgtggggcgtgcggtttag

DBGET integrated database retrieval system