KEGG   Granulicella tundricola: AciX9_1605Help
Entry
AciX9_1605        CDS       T01411                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acm  Granulicella tundricola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1858206..1858982
Genome map
AA seq 258 aa AA seqDB search
MPAPLQDRRILITRAAGQASTLATLLAERGAIPILIPTIELAPPTFWQPLDQAIQTIQTY
DWLLFTSANAVEAYVQRARTLNLPAQARRIAAIGPATARAVQGTGLAQAVDLIPARYVAE
SFAEALLPHAPNARMILVRAAEARDHLTQTLMAAGAHLTIAEAYRTIVPPASIEALKYAF
SNQAEPLDAITFTSASTARNLATLMESAALLIPHGTTLASIGPITSQAMRDLNLTPTIEA
KDSTIPSLVEALTQLFIN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacctcttcaagaccgccgcatcctcattactcgcgcagccggccaggcctct
acgcttgccaccctcctcgccgaacgaggcgctatccccatcctcatccccaccatcgag
ttggccccgccaaccttctggcagcccctcgatcaagccatccaaaccatccagacctac
gactggctcctcttcaccagcgccaatgcggtagaggcttacgtccagcgcgcccgcacc
ctgaacctcccggcccaggctcgccgcatcgccgccatcggccccgccaccgcacgagca
gtgcagggaaccggtctagcccaggcagtagacctcattcccgcgcggtacgtagccgag
tccttcgccgaagcgctgctcccccatgcccccaacgcccgcatgatcttagttcgagca
gccgaagctcgcgaccatcttacccagaccctcatggccgctggagcccacctcaccatc
gccgaagcctaccgcaccatcgtcccgccggcctccatcgaagccctgaagtacgccttc
agcaatcaagcagaacccctggacgccatcaccttcaccagcgccagcaccgcccgcaac
ctcgccaccctcatggaatccgcagccctgctgatcccgcacggcaccaccctcgcctcg
ataggtccgatcacctcgcaagccatgcgagacctgaatttgacccccacgatagaagcc
aaagactccaccatcccatccctggtagaagccctgacccagcttttcatcaactag

DBGET integrated database retrieval system