KEGG   Granulicella tundricola: AciX9_1663Help
Entry
AciX9_1663        CDS       T01411                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acm  Granulicella tundricola
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciX9_1663
Enzymes [BR:acm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AciX9_1663
Exosome [BR:acm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AciX9_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1923037..1924536)
Genome map
AA seq 499 aa AA seqDB search
MAQYVLSLDQGTTSSRAMLFDHDGKIAGMAQHEFAQHFPKTGWVEHDPMDILTTQLSAAV
EVLARAHVRPRDVVALGIANQRETTIVWERESGKPVYNAIVWQDRRTADFCAKLHDEGHE
ETFRNKTGLLIDPYFSSTKISWILDNVDGARALAEQGKLAFGTVDSWLIWNLTSGKRHIT
DRTNASRTLLYNIVEDRWDADLLKLLRVPESMMPEVVWSSEKVGRVTTTLGLGDVEIAGI
AGDQQSALFGQLCVNPGDAKNTYGTGCFLLQNIGDTFTLSKERLITTLTCTTNKKLQYAL
EGSVFVGGAVVQWLRDKMEFFEKSPDVEKIAASVDSSNNVVLVPAFTGLGAPHWDPYAGG
MIIGLQRSTEIGHIARAALESIAFQVTDVLHAMQADTSVGLTTMRADGGAAANDMLMQFQ
SDLLGIPVERPAILETTAQGAAYLAGLATGFWNDVEEIAKTRPEGQLFIPRMDPAIARKR
YLKWQDAVNRSKGWNKETA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtacgtactttcgctcgaccagggaacgaccagctcccgcgcaatgctcttc
gatcacgatggcaagatcgcaggcatggcccagcatgagtttgcacagcacttccccaaa
acgggctgggtcgagcacgaccccatggacatcctgacgacgcaattgagtgccgcagta
gaggtcctggcacgcgcccacgtccgtccccgtgacgtcgtcgccctgggcatcgcaaac
cagcgcgagaccaccatcgtctgggagcgggagagcggcaagcccgtctataacgccatc
gtctggcaggaccgcaggacagcggacttctgcgcgaagctccatgacgaaggtcatgaa
gagaccttccgcaacaagaccggcctgctcatcgacccctacttctccagcaccaagatc
tcctggatcttggacaacgtagacggtgcacgcgcgctcgcagaacagggcaagctcgcc
ttcggaaccgtggatagctggctcatctggaacctcaccagcggcaagcgccacatcacg
gaccgcaccaacgcctcgcgcacgctgctctacaacatcgtcgaagatagatgggatgcg
gacctgctgaagctgctccgcgtccctgagagcatgatgccggaggtcgtctggtccagt
gagaaagtgggtcgcgtcaccaccaccctcggtctgggcgacgtagagatcgcaggcatc
gcaggcgatcagcaatcagccctcttcggtcagctctgcgtgaatcccggcgacgccaag
aacacctacggcaccggttgcttcctgctccagaacatcggtgacaccttcaccctctcc
aaagagcggctgatcacgacgctcacctgcaccacgaacaagaaactccagtacgcgctt
gaaggcagcgtctttgttggcggagcggtcgtgcaatggctgcgtgacaagatggagttc
tttgagaagtcgcctgacgtggagaagatcgccgcctccgttgacagctccaacaacgtc
gtcctcgtccccgccttcaccggcctcggcgcaccgcattgggacccctacgcgggcgga
atgatcatcggtctgcaacgcagcacggagatcggccacatcgcgcgtgcggcgcttgag
agcatcgccttccaggtcacggatgtcctccacgccatgcaggccgataccagcgtcggc
ctcacgaccatgcgtgcggatggaggcgcagccgccaacgacatgctcatgcaatttcaa
tctgacctcctcggtatcccggtcgagcggcccgccatccttgagaccaccgcgcagggt
gccgcttatctcgccggcctcgccaccggcttctggaacgatgtagaagagatcgcaaag
acacgccccgaagggcagctcttcatcccccggatggaccccgctatagccaggaagcgt
tacctcaaatggcaggatgccgtgaaccgttcgaagggctggaacaaggagaccgcatga

DBGET integrated database retrieval system