KEGG   Granulicella tundricola: AciX9_1688Help
Entry
AciX9_1688        CDS       T01411                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acm  Granulicella tundricola
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AciX9_1688
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AciX9_1688
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AciX9_1688
Lipid biosynthesis proteins [BR:acm01004]
 Desaturase
  First
   AciX9_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1960077..1961162)
Genome map
AA seq 361 aa AA seqDB search
MTPATLTPESEATSTKPGSYAEFQAQAIETGEANEAALEAQIQDMSNAKPAMAADKVRAQ
VKQDLRLGREHQQGRINWITTIAMGAFHVFALVALLPIFWSWKNVSVFFVMYFLAINVGI
GVAYHRLLTHRGFRTPKWVEYFVTACGTMALEGGPIFWVATHRVHHQNSDQEGDPHTPVD
GTFWSHAGWILSGRAMHSETALLGRYAPDLTKDKVHVLLSKYHWVLLTATGVAQLALGAF
LAAPGHRVIGAVGMMLWGTMLRVVVGLHATWFVNSATHLYGARRFDTRDDSRNNWWVAIL
TGGEGWHNNHHAHPVSARHGLAWYEFDINYYCIWILSKIGLAKKVQIAKFDWENPKPAGV
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagccacactcactccggaatccgaagcgaccagcaccaagcccggcagctac
gccgagttccaggcccaggccatcgagaccggcgaagccaacgaagccgccctcgaagcc
cagatccaggacatgtccaacgccaagcccgccatggcagcagacaaagtccgcgcgcag
gtcaagcaggacctccgcctcggccgcgagcaccagcagggccgcatcaactggatcacc
accatcgccatgggtgccttccacgtcttcgctctcgtcgctcttctccccatcttctgg
tcctggaagaacgtcagcgtcttcttcgtcatgtacttcctggccatcaacgtaggcatc
ggcgtcgcctatcaccgcctgctcacgcaccgcggcttccgcacccccaaatgggttgag
tacttcgtcaccgcctgcggcaccatggcccttgagggcggacccatcttctgggtcgcc
acccaccgcgtccaccaccagaactcggatcaggaaggcgatccccacacccccgtagac
ggtaccttctggtcccacgcgggctggatcctctccggccgcgccatgcactctgagacc
gcgctcctcggccgttacgcccctgacctcaccaaggataaggttcacgtcctcctgtcc
aagtaccactgggtcttgctcaccgccaccggcgttgctcagctcgctctcggagccttc
ctcgctgcacccggccaccgcgtcatcggcgcggtcggcatgatgctctggggaaccatg
ctccgcgtcgtcgtcggcctccacgcaacctggttcgtcaactccgccactcacctctat
ggcgcacgccgctttgacacccgtgacgactcccgcaacaactggtgggtcgccatcctc
accggcggcgaaggctggcacaacaaccaccacgcccaccccgtcagcgcccgtcacggc
ctcgcctggtacgagttcgacatcaactactactgcatctggatcctctccaagatcggc
ctggccaagaaagttcagatcgccaagttcgactgggagaaccccaagccagccggcgtc
aactaa

DBGET integrated database retrieval system