KEGG   Granulicella tundricola: AciX9_1691Help
Entry
AciX9_1691        CDS       T01411                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
acm  Granulicella tundricola
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:acm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1963463..1965877
Genome map
AA seq 804 aa AA seqDB search
MTTTGASAELSVSPATAEELRKMDAYWRACNYLCVGMLYLLENPLLREPLKAEHIKNRLL
GHWGSDPGQTFTWVHLNRLIKKYDLDMIYIAGPGHGAPATLSNSYLEGVYSEVYPEKSED
VAGLQRFFKQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGFGAAFDNPDLIVTVVVGD
GEAETGPLATSWHANKFLNPKTDGAVLPILHLNGYKIANPTILARISPEELESLFRGYGW
TPYVVEGDDPAKMHVLMAEVLEKCVTEIRDIQAKARAEGATVVRPRWPMIILRTPKGWTC
PKELDGHKLEGSWRAHQMPIMDPKTNPDHLKLVESWMRSYKPEELFDESGKLIPELREMA
PSGTRRISGNPHANGGELRKPLDLPRFQDYGLKVEEPGQTEVSSTDTLGHFLRDVVRKNM
TSFRVFGPDETASNKLDAIYEASGKRWLAEMEASDADGGNLSIDGRVMEMLSEHTLEGWF
EGYVLTGRHGFFSSYEAFVHIIDSMFNQHAKWLEKSKLELRWRAPISSINLLITSLVWRQ
DHNGFTHQDPGFLDVVTNKSPEVTRIYLPPDANCLLSVADHCLRSVDYINVIVADKAPHL
QYLNMDEAVKHCTKGIGIWDFASSDAGADPDVILACAGDIPTSEALAAVAILRERCPELK
IRFINVVDLFRLMPEHAHPHGLSDQEFDGLFTTDKPVIFNFHAYPSLIHKLTYKRKNHAN
FHVRGYKEKGNINTPLELAILNQVDRFNLAIDVIDRVPGLMTTAAHTREWLKDEITDSVN
YAHENGIDRPEIRNWKWPAGSDKS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacaggcgcttctgctgaactgagtgtttcacccgcaaccgcagaagaactt
cgcaagatggacgcctactggcgcgcttgcaactatctctgcgtgggcatgctatacctg
ctggaaaaccctctgctgcgggagccgctgaaggcggagcacatcaagaatcgcctgctc
ggacactgggggtctgacccgggacagacctttacctgggtgcatctgaaccggctgatc
aagaagtacgacctggacatgatttacattgcggggccggggcacggcgcgccggcgaca
ctttcaaacagctaccttgaaggtgtgtactccgaggtctatccggagaagagtgaagac
gttgcggggctgcagcgattcttcaagcagttctcctttcccggcggaattgggagtcac
tgtacgccggagacgccgggttcgattcatgaaggcggcgagttgggttacagcctctcg
catggatttggagcggcgttcgataatccggatcttattgtgacggtggttgttggagat
ggcgaggcagagactggtccactggctacctcgtggcacgccaacaagtttctcaatccg
aagacggatggggctgttcttccgattcttcacctgaacggttacaagatcgccaatccg
acgatcctcgctcggatttctcctgaagagttggagagtctgttccgcggctatgggtgg
acgccttatgtcgttgaaggcgacgacccggctaagatgcatgtgctgatggccgaggtt
ctcgaaaagtgtgtgacggagatccgtgatattcaggccaaggctcgtgccgagggcgct
acggttgtgcgtccgagatggcccatgatcatcctgcggacacccaagggctggacgtgt
ccgaaggagttggatgggcacaagctggagggctcgtggagagcgcatcagatgccgatc
atggacccgaagactaatccggaccacctcaagctggttgagagctggatgaggagttac
aagccggaggagctgtttgatgagtctggcaaactgatcccggagttgagggagatggct
ccttcagggacgcggcgcatcagcggcaatcctcatgcgaacggtggcgaactccgcaag
ccgctggacctgccgcgattccaggactatgggctgaaggtcgaggagccggggcagacg
gaggtcagttcgaccgatacgctgggacactttctgcgcgatgtggttcggaagaacatg
acgagcttccgggtgtttggacctgatgaaactgcgtccaataagctcgatgcgatctat
gaggcgagcgggaagcgttggctcgcggagatggaggcgagcgatgcagacggaggcaat
ctctcgatcgacggacgtgtgatggagatgctgagcgagcatacgctggaaggatggttc
gaaggttatgttctgaccggccggcatggcttcttctcaagctatgaggcgttcgtgcat
atcatcgactcgatgttcaaccagcatgcaaagtggctggagaagagcaagctggagctt
cgttggcgtgcgcctatctcttcgatcaacttgctgattacgtcgctcgtctggcggcag
gatcacaatgggtttacgcatcaggacccgggatttctcgatgtcgtgacgaataagagc
ccggaggttacacggatctatcttccacctgatgcgaactgtctgctgagtgtggcggat
cattgcttgcggagtgtggactatatcaatgtgatcgttgctgacaaggcgccgcatctg
cagtacctcaatatggatgaggcggtgaagcactgtacgaaggggatcggcatatgggac
tttgcgagcagtgacgctggagccgatccggatgtcatcctcgcgtgtgccggcgacatt
cctacctcagaggctctggcggctgtggcgattctacgggagcgctgcccggagctgaag
atcaggtttatcaatgtggtcgatctcttccggctgatgccggaacatgcgcatccgcat
ggtttgtctgatcaggagttcgatggactcttcaccacggataagccggtgatcttcaac
ttccacgcttatccgtcgctgattcacaagctgacgtacaagcggaagaaccacgccaac
ttccatgtgcgcggttataaggagaagggcaacatcaatacgccgctggagcttgcaatc
ctgaaccaggttgatcgcttcaatcttgcgattgatgtgatcgatcgtgtgccggggctg
atgacgactgctgcccatacccgggagtggttgaaggatgagatcaccgattccgtcaac
tacgcgcatgagaatggaatcgaccggccggagatccgtaactggaaatggccggccgga
tcggacaagagctag

DBGET integrated database retrieval system