KEGG   Granulicella tundricola: AciX9_1786Help
Entry
AciX9_1786        CDS       T01411                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acm  Granulicella tundricola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX9_1786
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX9_1786
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciX9_1786
Enzymes [BR:acm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciX9_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2079527..2080921
Genome map
AA seq 464 aa AA seqDB search
MIESHKLRCTGCATEISGPNAPSDFRCPLCKNLYEVIYPWSIKGTQKEGVAAASLPNASA
LRWLWQERRTSTMPVDQSGVWRFRDLLPIVTDMNKVTTLREGNTPLYELPKSAKALGLHW
VLAKHQGMNPTGSFKDTGMTAALSVAVERGFEWVACASTGNTSAAMAAYAARAGLRSIVF
IPEGKIAWGKLSQSMDYGALTVQLKTDFDGCVRLVNELVRAYPIYLLNSVNPYRLEGQKT
PAFELLEQLEWQVPEHVIAPGGNLANASALAKGFAEAHQLGLIPRIPKISIIQAQDANPL
YTFMHQPGGTDGRELIPVTAETRASAIRIGNPASWRKAVNALQTTGGWCEEVTEQEIALA
KAQIGAEGIGCEPASAVTLAGLKKLVADGRVKEKDRAVLILTGHTLKDSDYTIQYHRNEL
FTNQETAALTPEEAAQHTHLRKPPIVLEANRETVLSALEAQMKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtcacacaagcttagatgcacaggatgcgctaccgagatctccggcccaaat
gcccccagcgacttccgctgcccgctctgcaaaaacctctatgaagtcatttatccctgg
tcgatcaaaggtactcagaaggaaggcgtagcagccgcatccctccccaacgcctcagcc
ctccgctggctctggcaggagcgccgcacctccaccatgcccgtagaccagtccggcgta
tggcgcttccgtgacctcctccccatcgtcacggacatgaacaaggtcacgacgctgcga
gagggcaacacccccctctacgaacttcccaagtccgccaaagcccttggcctccactgg
gtcctcgccaagcaccagggcatgaaccccaccggctccttcaaggacaccggcatgacc
gccgccctctccgttgcggtcgagcgaggctttgagtgggtcgcctgcgccagcaccggt
aacacctccgccgccatggccgcctacgccgcccgcgccggcctccgctccatcgtcttc
atccctgagggcaagatcgcctggggcaagctctcccagtccatggactacggagccctc
accgtccagctcaaaacagacttcgacggctgcgtccgcctcgtgaacgagctcgtccgc
gcctaccccatctatctcctcaactcggtcaacccctaccgcctggaaggtcagaagacc
cccgccttcgagctcctggagcaactggagtggcaggtccccgagcacgtcatcgccccc
ggcggcaacctcgccaacgccagcgccttggcaaagggcttcgcggaagcccatcaacta
ggcctcatcccccgcatcccaaagatctccatcatccaggcccaggacgccaaccctctc
tacaccttcatgcaccaacccggcggcacagacggcagggaactgatccccgtcaccgcg
gagacccgagcctccgccatccgcatcggcaaccccgcctcctggcgcaaggccgtcaac
gccctccagaccaccggaggctggtgtgaagaggtcaccgagcaggagatagccctcgcc
aaagcccagatcggtgccgaaggcataggctgcgagccagcctcagcagtcaccctggca
ggcctgaagaagctggtagcggatggtcgagtcaaagaaaaagaccgcgccgtgttgatc
ctcacaggccacaccctcaaggactccgactacaccatccaataccaccgcaacgagctc
ttcaccaaccaggaaaccgccgccctaaccccagaagaagccgcccaacacacccacctc
cgcaaaccccccatagtcctcgaagccaaccgcgaaacagtcctctccgccctcgaagcg
caaatgaaggcgtaa

DBGET integrated database retrieval system