KEGG   Granulicella tundricola: AciX9_1925Help
Entry
AciX9_1925        CDS       T01411                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
acm  Granulicella tundricola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AciX9_1925
DNA repair and recombination proteins [BR:acm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AciX9_1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2258830..2259432
Genome map
AA seq 200 aa AA seqDB search
MTQRFAEPMARLIDELRKLPGIGTKTAQRLAFHVLRSPGEDADALADAIREIKKHLRLCS
VCNNITDVDPCHYCSNPVRSHRLICVVEEPTNIATVERTRSYNGVYHVLHGTLSPIGGVG
PEQLRIRNLLTRLEDVDEVILATSPTIEGEATAGYIAGELRRVKSGVKVTRIATGVPAGS
DIEYADEVTMTRAMEGRREF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaacgctttgcagagccgatggcgaggctgatcgacgagctgcgtaagctgcct
gggattgggacgaagacggcgcagcggctggcgtttcatgtgctgcgttcgccgggcgag
gatgcggatgcgctggccgatgccatacgtgagattaagaagcatctgcggctctgctcg
gtgtgcaacaacattacagacgtcgatccatgccactactgctcgaatccggtgcggagt
catcggctcatttgcgtagtggaggagccgacgaacatcgccacggtagagcggacgcgg
agctacaacggcgtctaccatgtgctgcatggcacgctctcgcccatcggcggggtcggg
ccggagcagctacggattcggaatctgctgacccggctggaggatgtggacgaggtgatc
ctggccacgtcgcctacgattgaaggcgaggcgaccgcagggtatatcgcaggggagctg
cggcgggtaaagagcggggtgaaggtgacgcggatcgctacgggcgtgccggccgggagc
gatatcgagtacgcggatgaggtgacgatgactcgggcgatggaaggtcggcgggagttt
tag

DBGET integrated database retrieval system