KEGG   Granulicella tundricola: AciX9_2287Help
Entry
AciX9_2287        CDS       T01411                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
acm  Granulicella tundricola
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:acm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2675731..2676474
Genome map
AA seq 247 aa AA seqDB search
MNVLWYFERMQKFVGSFILAGLLSGLAGCKTDDGGRTSPEVAENNAPGPVEAPKAAIRKA
DVVDGRPLVVCFGDSLTAGYGAEDGASYPDFLQKDLDGAGYRYRVVNEGISGNTTKDGVD
RLAGVERMKAAVVVLEFGGNDGLRGFDVKTTRANLATMIEGLKASGAKVVLAGITLPPDY
GADYVTSFTANYPVLAKKYGVPVLPFLLKDVYGVPGMMQGDRTHATEKGNAVVARNVLPL
VEPLLRK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgttctttggtattttgagaggatgcagaagtttgtcggctcttttattttagcg
ggtttgttgtcgggtctggctggttgtaagacggatgatgggggtaggacgtctccggag
gtggcggaaaacaacgcgccggggccggtggaggctcccaaggctgcgatacggaaggcg
gatgtggtggacggccggccgctggtggtttgttttggggatagtttgacagcgggctat
ggggctgaggatggggcgagctatccggattttctgcagaaggacctggatggagcgggg
tatcggtaccgggtggtgaatgaggggatcagcgggaatacgacgaaggatggggtggac
cggctggcgggggtcgagcggatgaaggcggcggtggtggtgctggagtttgggggcaat
gatgggctgcgggggttcgacgtgaagacgacgcgggcgaatctggcgacgatgatcgaa
gggctgaaggcgagtggggcgaaggtggtgctggcggggattacgctgccgcctgattat
ggggcggattatgtgactagctttactgcgaattatccggttttggcgaagaagtacggt
gtgccggtgctgccgtttttgctgaaggatgtgtatggggtgccggggatgatgcagggg
gatcggacgcatgcgacggagaaggggaatgcggtggtggcgcggaatgttttgccgctg
gtggagccgctgctgaggaagtag

DBGET integrated database retrieval system