KEGG   Granulicella tundricola: AciX9_2525Help
Entry
AciX9_2525        CDS       T01411                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acm  Granulicella tundricola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX9_2525
   01230 Biosynthesis of amino acids
    AciX9_2525
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_2525
   00051 Fructose and mannose metabolism
    AciX9_2525
   00562 Inositol phosphate metabolism
    AciX9_2525
Enzymes [BR:acm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AciX9_2525
Exosome [BR:acm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AciX9_2525
  Exosomal proteins of bladder cancer cells
   AciX9_2525
  Exosomal proteins of melanoma cells
   AciX9_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2955757..2956557
Genome map
AA seq 266 aa AA seqDB search
MKTEIRQKFIVGNWKMHTTSFEAQQLAKGIVDGLAAPDHVTVVLCPPFPYLPIVGDMLRG
SRVALGAQNVYPETEGAFTGEVSPNMLLDLDCKYVIVGHSERRHKLGESEAFINRKVKCA
LDSGLDVILCVGETLEQRQGGRTEAVLDHQLSTGLDGVSSDMLSHLSVAYEPVWAIGNDE
HHATPQQAHDTHVLIRRKLTQILGATWSEELSVHYGGSVEPGNAAAFLGQDGIDGVLIGG
ASLKADEFLAIVNAGICETEAEMQTA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggaaatccgccagaaattcattgttgggaactggaagatgcacacgacctca
ttcgaagcccagcaactcgccaagggcatagttgatggcttggccgcgccggaccacgtc
acagtagtcctctgcccaccgttcccgtaccttccgatcgttggagacatgctcaggggt
agccgggtcgcgcttggcgcgcagaatgtttacccggaaaccgaaggcgccttcaccggc
gaggtgagcccgaacatgttgctcgatctcgactgcaaatacgtcatcgtgggacatagt
gagcgcagacacaagctaggcgaatccgaagcttttatcaatcgtaaagtgaagtgtgcg
ctcgattcaggtttggacgtgatcctttgcgtgggcgagactctagagcagcgacaaggc
ggacggacggaggcggtactcgatcatcagctcagcaccggattggatggagtatcgtcc
gatatgttgtctcacctcagcgtcgcctacgaaccagtgtgggcgatcggcaacgacgaa
catcatgcaactcctcaacaggcgcatgatacgcatgtgctcattcggagaaaactcact
cagatacttggggcgacgtggtccgaggagctatcggtccattacggtggcagcgttgaa
ccggggaatgcagccgcgtttttgggtcaggacggcatcgacggtgttctgattggcggt
gccagtctgaaggccgatgagtttctcgccatcgtcaatgcgggtatttgtgaaacagaa
gcggaaatgcagaccgcgtga

DBGET integrated database retrieval system