KEGG   Granulicella tundricola: AciX9_2541Help
Entry
AciX9_2541        CDS       T01411                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
acm  Granulicella tundricola
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AciX9_2541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_2541
  Lipid metabolism
   00071 Fatty acid degradation
    AciX9_2541
  Amino acid metabolism
   00350 Tyrosine metabolism
    AciX9_2541
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciX9_2541
   00626 Naphthalene degradation
    AciX9_2541
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AciX9_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2972200..2973192)
Genome map
AA seq 330 aa AA seqDB search
MQAAIFRHSAKDTKPYLSIEDVPRPTMLPGHSLLRMIACGVCRTDLHIVTGELPALRTQL
IPGHQIVGEVVDGATPNFPIGMRVGVSWMGGVDGTCWYCMHSAENLCDEPVFTGYTVDGG
YAEFVLVRTDFLLPLPVGLDDAAAAPLLCAGIIGFRSLRVAGVEPGEKVGLHGFGSSASL
AIQVLHSWNCEVYVSSRGQGNRDRAAALNATWVGKDGDKPPVALDRAITFAPSGEVVIAA
LSALRKGGVVAVNAIHMAQIPAFDYDSLLWGERQIRSVANMTRADARDFLEIAHTLGIRP
KTTVLKLEQANEALAMLSRDRDDSSIVLVP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggctatctttcgtcattccgctaaggatacgaagccgtatctcagcatcgaa
gatgttccgcgcccaaccatgcttccggggcactctctcttgcgcatgatcgcttgtggt
gtatgccggactgacttgcacatcgtgactggagagttacccgcattgaggacgcagctg
atccccggccatcagatcgtcggcgaagtcgtcgacggtgcaacaccaaacttccccatt
ggaatgcgtgtcggagtctcctggatgggtggagtggacggtacttgttggtactgcatg
catagcgcggaaaatctttgtgacgagccagtcttcaccggatacacagtcgatggaggg
tacgcagagtttgttcttgtacgcaccgacttcctgctgccactccccgttggcttggac
gatgccgcagcagcgccgcttttgtgcgccgggattattggctttcgcagccttcgtgtg
gcgggagttgaacctggtgaaaaagtaggacttcacggcttcggtagctcggcaagcctg
gcaatccaggtgttgcactcttggaattgcgaggtatacgtctcatctcgcggccagggc
aatcgtgaccgcgccgccgctttaaacgcaacatgggtaggaaaagacggggataagccg
cccgttgcgctggatcgtgcgatcacctttgctcccagcggagaggttgtgatcgcagcg
ctgagcgcacttcgcaaaggtggcgtcgtagcggtcaacgccattcatatggcccagatt
ccagcattcgactacgacagcctgctctggggcgagcggcagatacgcagcgtcgcaaac
atgacccgggctgacgcccgcgactttcttgagattgcacatacgctcggtatacgcccg
aagacgactgtactgaagttagaacaggcgaatgaagcgctggccatgcttagcagagat
cgcgacgatagctccattgtccttgttccatag

DBGET integrated database retrieval system