KEGG   Granulicella tundricola: AciX9_3063Help
Entry
AciX9_3063        CDS       T01411                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
acm  Granulicella tundricola
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:acm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3539824..3541104
Genome map
AA seq 426 aa AA seqDB search
MKLVKTYGESAKAAAALIESIEQRGATNTARVENTVSTILADVRQGGDEAVMEYAARFDG
LQCINGKSQPLLVTREEMKAAWDDTDATLREAMEIAQANIRAFAEAQKPGEWTIEPAAGV
QTGQIVRPLGSVGCYVPGGRYPLPSTLIMTVTPAQVAGVARIVVCSPKPAKETLAAGWLC
GVTEFYRMGGAQAVAAMAFGTQTIGRVEKIVGPGNLYVTAAKAAVSHECGIDMPAGPTEI
GVMSEHGDPAGIAADLVAQAEHDPETLAVLITPSETLAEAVLAEVKQQAKANEIAEQSLT
AQGAIFVTKTVTEAQDLTNRLAFEHLTVDNTTDLKWVQNAGSVFVGQYSPQSMGDYVSGP
NHVLPTGRAGRIRGGLSVMDFLKIITVQEYTRSGLAHLGPHAIAMAEAEGLVGHAESVRV
KMGGKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtcaaaacatacggcgaatcggccaaggccgcggccgcgctgatcgaatcc
atcgagcaacgcggcgcaaccaacacggctcgcgtggagaacacggtcagcacgatcctc
gcggacgtgcgccagggcggcgatgaagctgtgatggagtatgccgcccgctttgacggc
ctgcaatgcatcaacggcaaatcgcagccactcctcgtcacccgcgaggagatgaaggcg
gcctgggacgacaccgacgcgaccttgcgcgaggcaatggagatcgcgcaagccaacatc
cgcgccttcgcggaagcccagaagcccggggagtggaccatcgagcccgccgccggagtg
cagactggccagatcgttcgtccgctcggaagcgtcggttgctatgtccccgggggccgt
tatcccctgccctccacgctcatcatgaccgtcacgcccgcacaggtcgctggcgtggcc
cgcatcgtcgtctgctcccccaagcccgcaaaggagacccttgctgcaggctggctctgc
ggcgtgacggagttctatcgcatgggcggcgcgcaggccgtcgcagccatggccttcggc
acgcaaaccatcggccgcgtagaaaagattgtgggccccggcaatctctacgtcaccgcc
gccaaggcagccgtgtcgcatgagtgcggtatcgacatgcccgccggccccaccgagatc
ggcgtcatgagcgagcatggcgaccccgccggcatcgccgctgacctcgtcgcgcaagcc
gaacacgatcccgaaaccctagccgtcctcatcacccccagcgagaccctcgcagaagcc
gtcctagcagaggtaaagcagcaggcaaaggctaacgagatcgccgagcagtcgctcaca
gcacaaggcgcgatattcgtaaccaaaacagtcacagaagcacaagacctcaccaaccgc
ctggccttcgagcacctgacggtagacaacaccaccgatctgaagtgggtccagaacgcc
ggctccgtcttcgttggccaatactccccacagtccatgggcgactacgtaagcggcccc
aaccacgtcctgcccaccggccgcgcaggccgcatccgtggcggcctcagcgtcatggac
ttcctcaagatcatcaccgtgcaggagtacaccaggtccggcctcgcccatctcggtccc
cacgccatcgcgatggctgaagccgagggccttgtaggccacgctgaaagcgtccgcgta
aagatgggaggcaagcaatga

DBGET integrated database retrieval system