KEGG   Granulicella tundricola: AciX9_3151Help
Entry
AciX9_3151        CDS       T01411                                 

Definition
alcohol dehydrogenase zinc-binding domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
acm  Granulicella tundricola
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AciX9_3151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_3151
  Lipid metabolism
   00071 Fatty acid degradation
    AciX9_3151
  Amino acid metabolism
   00350 Tyrosine metabolism
    AciX9_3151
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciX9_3151
   00626 Naphthalene degradation
    AciX9_3151
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AciX9_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3628317..3629390
Genome map
AA seq 357 aa AA seqDB search
MKSWKIDRLGDKLSFVDVPIPEVRPGSVLVRVQSQALMSYLKPYVEGKLPAYRAPEDFTP
GGNAIGTVEAVGADVWHLKKGQRVVTSSHLVARENVPEPGQVLIGVTSPGGIGDALQSSW
KDGTLAEYVLLPAQVVTPINGLDHYDFPQLTAITRCIVPFGGLTRGRLQAGETVVVNGAS
GAYGSAATLVALAMGASRVVAAGRSKETLDKLAKAGGERVIPVVLTGDVTKDTEALRSAA
NGGAHLAFDQVGNAKDPNSTLAALGSLYRWGRIVLMGSSAVPIPINYLQMMFNNWEIIGN
FMHPQGAYLPLLSLVRSGQLDLNPIQPRVFSLPDLEPAMEYAGKAGSLELTVVTSSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtggaagattgaccgccttggcgacaaactcagtttcgttgatgttcctatt
ccggaggttcgccccggaagcgtgctggttcgtgtccagtcgcaagctctgatgtcctat
ctgaagccttacgtggagggcaagctgccggcctatcgtgccccagaagatttcaccccg
ggtggcaatgctatcggaacggttgaggctgtcggtgctgatgtgtggcacctcaagaag
ggccagcgagtcgtgacgtcgagtcaccttgtcgcacgagagaacgtacccgagcccgga
caggttctcatcggagtaacttccccgggaggcattggagatgcactccagagttcttgg
aaggacgggacactggctgagtacgttcttctacccgctcaggttgttactccgatcaac
ggtcttgaccattatgacttccctcaactcaccgccattacccgctgcatcgttccgttt
ggaggcttgacgcggggaagactccaagcgggtgagacggtggtggtgaacggcgccagt
ggtgcttacggaagcgccgcaactctcgtcgcccttgcaatgggcgcgagtcgcgtggtc
gcggccggccgcagcaaggaaacgctcgataagctagccaaagctggcggcgaacgagtg
attcccgttgtcctcactggcgatgtgacgaaggacactgaggctttgcgaagcgccgcc
aacggaggcgcccatttagccttcgatcaagttggaaacgccaaggatcctaattccacg
ctggcggcacttggttcgctctatcgctgggggcgcatcgtgctcatggggagcagcgcc
gttccgattcccatcaattacctccagatgatgttcaacaactgggagatcatcggaaac
ttcatgcaccctcaaggggcgtacttgccccttctgtcgttggtccgatccggccaactg
gacctgaacccaatccaaccaagagtcttttcgttgcccgacctggaacccgcaatggag
tacgcaggcaaagcaggcagcttggaattgaccgtcgtgacctccagcaagtag

DBGET integrated database retrieval system