KEGG   Granulicella tundricola: AciX9_3229Help
Entry
AciX9_3229        CDS       T01411                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acm  Granulicella tundricola
Pathway
acm00020  Citrate cycle (TCA cycle)
acm00640  Propanoate metabolism
acm00660  C5-Branched dibasic acid metabolism
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01130  Biosynthesis of antibiotics
acm01200  Carbon metabolism
Module
acm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX9_3229
   00640 Propanoate metabolism
    AciX9_3229
   00660 C5-Branched dibasic acid metabolism
    AciX9_3229
Enzymes [BR:acm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AciX9_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADW70240
UniProt: E8X1K5
Position
complement(3705317..3706486)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEILRKYNVPVPGGEMATTLEEADTAAKALFAAGNTVVVVKAQIHAGGRGKG
GGVKVAKSLDDANTASKAILGMQLITHQTGPTGQKVQRLLIEEGSLIDRELYLGLVLDRA
SAKVVFMASQSGGMEIEEVAHATPDLIYKEYVDPVVGLQPWQARSLAFKLGLTTAQINPA
VSFMMGLYKAFIETDSTLMEINPFITTKDGKLMALDCKINFDDNAMFRHKDLKELRDLAE
EDPLEVEASKFALNYIKLDGNIACMVNGAGLAMATMDIIEYAGGKAANFLDVGGGANQEQ
IENAFGILLSDPNVKAIFINIFGGILRVDVLATAVVAAARKLNVQLPIILRLEGTNVEEG
RKILAESGLKFEVGTTMKEAADLAVKAAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccaggccaaagagatcctccgcaagtacaacgtgcccgtcccg
ggcggcgagatggccaccacccttgaagaagcagacaccgccgccaaggcgctcttcgca
gccggaaacacggtcgtcgtggtcaaagcgcagatccacgccggtggccgaggcaaaggc
ggcggcgtcaaggtcgccaagtcgctcgacgatgccaacaccgcgtccaaagccatcctc
ggcatgcagttgatcacccaccagaccggccccaccggccagaaagtccagcgcctcctc
attgaggaaggctccctcatcgaccgcgagctctacctcggcctggttctcgaccgcgcg
tcagccaaggtcgtcttcatggcctcgcagtccggcggcatggagattgaggaggtcgcc
cacgccaccccggacctcatctacaaggagtacgtcgaccccgtcgtcggcctccagccc
tggcaggcacgctccctcgccttcaaactcggcctgacgaccgcccagatcaaccccgcc
gtctccttcatgatgggcctctacaaggccttcatcgagaccgactccaccctcatggag
atcaaccccttcatcaccaccaaagacggcaagctcatggcgctcgactgcaagatcaac
ttcgacgacaacgccatgttccgccacaaggacctcaaggagcttcgcgacctcgccgag
gaagacccgcttgaggttgaagccagcaagttcgccctcaactacatcaagctcgacggc
aacatcgcctgcatggtcaacggtgccggcctcgccatggccaccatggacatcatcgag
tacgccggcggcaaggcagccaacttcctcgacgtaggcggcggagccaatcaggagcag
attgaaaacgccttcggcatcctcctctcggaccccaacgtcaaggccatcttcatcaac
atcttcggcggcatcctacgcgtagacgtcctcgccacggcagtcgtagccgctgcccgc
aagctcaacgtccaactccccatcatcctgcgccttgagggcaccaacgtagaagagggc
cgcaagatcctcgcagaatccggcctcaagtttgaagtaggcaccaccatgaaagaagcc
gcagatttagccgtgaaggcagcagcatag

DBGET integrated database retrieval system