KEGG   Granulicella tundricola: AciX9_3502Help
Entry
AciX9_3502        CDS       T01411                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acm  Granulicella tundricola
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AciX9_3502
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AciX9_3502
Enzymes [BR:acm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AciX9_3502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4005288..4006244
Genome map
AA seq 318 aa AA seqDB search
MTTAAGYALGSLLTVDGLAVSEVSRILALTSHLEAMAPEERSQVLKGRRVALLFYESSTR
TRTSFELAAKSLGATTTLVSDKSSSIEKGESLKDTGLTLRALGAECIILRHPAGGAPFVL
AQTTGLPVLNAGDGMHQHPSQALLDLRTILSRLGRTDKPVDEHVLDGVTVTIAGDIRHSR
VARSNAMLLPRLGARVLLCGPPELLPEEALGLGDGIEIVRDFDAALKRSQVVMMLRIQRE
RLAGLEIDLADYIIHYQLNEERLQAYAPRAVVMHPGPMIRGLEIQGEVADSAQSAIEEQV
RHGQAVRAALLVRALEQA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccgccggctatgcgttggggtctttgctgacggtcgatggactggccgtc
agtgaggtcagccgcattcttgcgctgacctcgcacctggaggcgatggctcccgaggag
cgatcgcaggttctaaagggccgccgcgtggctctgctgttttacgagtccagcacccgt
acccgcaccagctttgagcttgcagccaaatcactcggcgcgacaactacgttggtctcg
gacaagagttcctcgattgaaaaaggcgagagcctgaaggataccgggcttactctgcga
gcgctgggcgcggagtgcatcatcctgcggcatcccgccggcggggctccgtttgtgctg
gcgcagacgactgggctgcccgtgttaaatgcgggcgacggcatgcaccagcatccctcg
caggcgctgcttgatctgcggacgattctctcgcggctaggacgcacggacaaaccagtg
gatgagcatgtcctggatggcgtcaccgtgacgatcgccggagacattcgccacagccgt
gtcgctcgctcaaacgcgatgctgctacctcgtctcggtgcgcgagtgttgttatgcggc
cctccggagcttctgccggaagaagcgctgggactgggcgatggcattgagattgtgcgc
gactttgatgcagcgctgaagcgctcacaggtcgtcatgatgctgcggattcagcgcgaa
cggctggctgggctggagatcgatcttgccgattacatcatccactaccagttgaatgaa
gagcggcttcaggcctatgcgcctcgcgccgtcgtgatgcatccagggccgatgattcgt
gggcttgagattcagggcgaggtcgctgattccgcgcagtcagccattgaagagcaggtc
cggcatgggcaggccgtaagggcggcgttgctggtccgcgcgcttgagcaggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system