KEGG   Granulicella tundricola: AciX9_3715Help
Entry
AciX9_3715        CDS       T01411                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acm  Granulicella tundricola
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AciX9_3715
Enzymes [BR:acm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AciX9_3715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4227314..4227787
Genome map
AA seq 157 aa AA seqDB search
MIAAIALGSNLSSTFGGREATLHIAVERLGAVGKVTAVSAFYDTEPVGYTDQPRFLNGAV
LLETDLSPAELMRTLLGIELGMGRQREGVPAKGPRVIDLDLLFVGDLVVQSAELTLPHPA
MHERAFVLEPLAGIAPHWKHPILGLTVVEMLSRLENS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccgccatcgcgctgggctcgaatctctcttcaacctttggcggccgtgaggcg
accctgcatatcgcagtagaacgtctgggtgcggttggcaaggtgacggcagtctcagcg
ttctacgatacggagccggtgggctacacggatcaaccgcgcttcctgaacggcgctgtg
ctccttgaaacagacttgtctcctgcggaactgatgcggaccctactcggtatcgaactt
ggcatgggcaggcagcgcgaaggcgtacccgccaaaggcccgcgcgtgatcgacctggac
ctcctgtttgtgggcgatctggtcgtccagtcggcagagctgacgctgccgcatccggcg
atgcacgaacgagccttcgtactggagccgctggccgggatcgcaccacactggaagcat
ccgatcctggggcttacggttgtagagatgctctcgcggcttgagaatagctag

DBGET integrated database retrieval system