KEGG   Granulicella tundricola: AciX9_3756Help
Entry
AciX9_3756        CDS       T01411                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acm  Granulicella tundricola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AciX9_3756
Enzymes [BR:acm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AciX9_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4278448..4279038)
Genome map
AA seq 196 aa AA seqDB search
MIAHLRGLLLFKSTNQAVVECGGVGYDVAISVATYSALPREGAEAKLFIFTKVAEEQLAL
FGFSDRQEKSLFEKLLTITGIGPKLAITVLSGIAADRLVTAIRGGDHDTLVKIPGIGKKT
AERVVLELKDKLDDMATAPVAAVQSHGPAGDDVLSALVNLGYARPQAQKAIEMALRDPGA
AGSFEVLFRAAMNHIR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcatctgcgcgggttgctgcttttcaagtctacaaaccaggctgttgtggag
tgcgggggcgtgggatacgacgtggccatctcggtcgcgacgtactccgcgctgccgcgc
gagggggcggaggctaagctgtttatcttcaccaaggtggcggaagagcagcttgcgctg
tttgggttctcggaccggcaggagaagagcctgttcgagaagctgttgacgattaccggc
atcgggccgaagctggcgattacggttttgagcggcattgcggcggaccggttggtgacg
gcgatccggggtggggatcacgacacgctggtgaagattccgggcatcggcaagaagacc
gccgagcgggtggtactggagctcaaagacaagctggacgacatggccacagccccagtg
gcggcggtgcagagtcatgggccggctggggacgatgtgctttcggcgctggtgaacctg
gggtatgcgaggccgcaggcgcagaaggccatcgagatggcgttgcgtgatccgggtgct
gcggggagctttgaggtgctgttccgggcggctatgaatcacatccggtag

DBGET integrated database retrieval system