KEGG   Granulicella tundricola: AciX9_3820Help
Entry
AciX9_3820        CDS       T01411                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
acm  Granulicella tundricola
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AciX9_3820
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciX9_3820
   00600 Sphingolipid metabolism
    AciX9_3820
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AciX9_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pACIX902:complement(48491..50065)
Genome map
AA seq 524 aa AA seqDB search
MMLTKTLTNKTCLLSGLLLSTALIAQAQTGLNGYWDLRLPNTDGSFRHTYLELNASGETV
SGKLFGRNVGGQAIEGTLKAGKIRFATVPPPLKPGSPASIGSTVTPIVYDGTFADGKLTL
EFHRYNGGSVTGEAIRTTREAAVPPAPLPLPAPKDIPDNGLVRTPPMGWNSWNKFAGKIT
ADDVKSMADAMVATGMNKAGYQYINIDDTWEADRAADGTIQTNNKFPDMKGLADYVHSKG
LKIGIYSSPGGKTCAGYEGSFGHEAQDAKTFAAWGIDYLKYDLCGARAIYESTLENERGL
YQKMGEALSQSSHPIVYSLCQYGDADVWKWGSKVGGNLWRTTGDIRDTWESMDKIGFSQI
AISSYTRAGHWNDPDMLEIGNGGMTPDEYRTHMSLWSMLAAPLIAGNDLRSMSPETSSIL
LNKEVIAIDQDKAAKPVQALSTKGKVETIWRPMEDGSIIVGIYNRGDAATPANLPWSSLP
AGYATKHVSVRDLWKHEAVPANGPAYTASIPPHGVALLRIGAAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaccaagaccctcaccaacaaaacctgcctgctctccggcctcctgctctcc
acagccctcatcgcgcaagcccagaccggcctcaatggctattgggatctacgcctccca
aacacagacggcagcttccgccacacctatctcgaactcaatgcctcgggcgaaaccgtc
tccggaaaactcttcggcagaaacgtcggcggccaggcaatcgagggcaccctcaaagcc
ggcaagattcgcttcgccacagtcccgcccccactcaagcccggctcacctgcctcaatc
ggctcaacggtaacgcccatcgtctacgacggcacctttgccgatggcaagctcacgctg
gagttccacagatacaacggtggctccgtcactggtgaagccatccgcaccacacgcgag
gccgcagtcccacccgcaccgctccccctccccgcgcccaaagatatcccggacaacggc
ctcgtccgcaccccgcctatgggctggaacagttggaacaagttcgccggcaagatcacc
gcggacgacgttaaaagcatggccgacgccatggtcgccaccggcatgaacaaggccggc
taccagtacatcaacatagacgacacctgggaagcggaccgcgccgccgacggcaccatc
cagaccaacaacaaattccctgacatgaagggcctcgcagactacgtccactccaagggc
ctcaagatcggcatctactcctcacccggaggcaaaacctgcgccggctatgaaggcagc
ttcggccatgaagcccaggatgccaaaaccttcgcagcctggggcatcgactacctcaag
tacgatctctgcggcgcacgcgccatctatgagtccaccctggaaaacgagcgcggcctc
taccagaagatgggtgaagccctctcccaatccagccatcccatcgtctacagcctctgc
cagtacggtgacgccgatgtctggaagtggggctcaaaggtcggcggaaacctctggcgc
accaccggagatatccgcgacacatgggagtccatggacaagatcggcttcagccagatc
gccatctccagctacacccgcgctggccactggaacgatccagacatgctcgagatcggc
aacggcggcatgaccccagacgagtaccgcacccacatgagcctctggtccatgctcgcc
gctcccctcatcgccggcaacgacctccgctccatgtcgcccgagacctcatccatcctg
ctcaacaaggaggtcatcgccatcgatcaggacaaagccgccaagcccgtccaggccctc
tccaccaagggtaaagtcgaaacgatctggcgtccgatggaagacggctccatcatcgtc
ggcatctacaaccgtggcgacgcagccactccagccaacctcccctggagctccctgccc
gccggctacgccacaaagcacgtcagcgtaagagacctctggaagcatgaggccgttccc
gcaaacggccccgcctacaccgcctccatccccccgcacggagtagctctcctcagaatt
ggagcagcaaagtag

DBGET integrated database retrieval system