KEGG   Granulicella tundricola: AciX9_3990Help
Entry
AciX9_3990        CDS       T01411                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
acm  Granulicella tundricola
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:acm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:acm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pACIX902:294164..295579
Genome map
AA seq 471 aa AA seqDB search
MIRHSLFACTALVLFSSSVAHAQTKPDVDVWLTNSDRTALLARQSPELKFVAGAGSGTVI
QVDDTKRFQQMDGFGYALTGGSAELLMKMQPAKRTELLQELFGVKGSAIGVSYLRVSIGA
SDMNERVFTYDDLPAGETDPMLAKFGLGPDLQDVVPVLKEILAIDPKIAILASPWTAPSW
MKTNELPKGGSLKPEDYEVYAQYFVKYLHAMAAEGITIKAITMQNEPRNPKNTPSMVMTA
DEQKTFLADALGPALHKAGLKTDVILYDHNCDDPEYPLTALADPKASQYAKGSGFHLYEG
TIDAMSKVHDAYPSKDLYFTEQMVIQKDATKPLRVADTVSHLIVGAPRNWSRNVLLWNLA
ADPDNGPHTPNGGCPICQGAITLDGDQVTRNLAFYTLAHASKFVRPGSVRVESGSSVAGV
LPNVAFSTPDKGMVLIVANPGKEQQAFSVEFHHKSFSATLNAGDVATYVWR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgattcgccactcactttttgcttgtaccgcgcttgtcttgttcagttcctctgttgca
catgctcagaccaaaccggacgtcgatgtatggctgaccaactccgatcggacggctctg
cttgcgaggcagagccctgagttgaagttcgtcgcgggcgcggggagcggcaccgtgatc
caggtggatgacacgaagcgttttcagcagatggacggcttcggctatgcgctgactggc
gggagtgcggagctgctgatgaagatgcagccggcgaagcggacggagctgctgcaggag
ttgtttggggtcaaggggagcgctatcggcgtctcgtatctgcgggtcagtatcggcgct
tcggatatgaacgaacgagtctttacctatgacgacctgcctgcgggggagaccgatccg
atgctggcgaagttcgggttgggaccggacctgcaggacgtcgtgccggtgctgaaggag
attcttgcgatcgatccgaagattgcgatcctggcgagtccctggactgcgccctcctgg
atgaagacgaatgagctgcccaagggtgggagtctgaagcctgaggactatgaggtctat
gcccagtactttgtgaagtacctgcacgcgatggcggctgaagggatcacgatcaaagcg
atcacgatgcagaacgagcctcggaaccccaagaacactcccagcatggtgatgactgcg
gacgagcagaagacgtttcttgcggatgccttggggccggccctgcataaggcgggactc
aagaccgatgtgatcctctacgaccataactgcgacgatccggagtatccgctgacagca
ctggcggacccgaaggcgagccagtatgcgaaggggtctggctttcatctgtatgaggga
acgatcgatgccatgagcaaggtgcatgacgcatacccgagcaaggacctctatttcacg
gagcagatggtgatccagaaggatgcgacgaagccgttgcgagttgcggatacggtgagt
cacctgatcgttggggcgccgcgtaactggagcaggaatgtgctgctctggaatcttgcg
gctgatccggataacgggccgcatacgccgaatggcggctgcccgatctgccagggggcg
atcacgctggacggcgaccaagtcactcggaatctggccttttacacgttggcgcacgcc
tcaaagtttgtgcggccgggatcggtgcgggttgagtctgggagttcggttgcgggtgtg
ctgcctaatgtcgcgttctctacgcctgacaagggtatggtgctgattgtggctaatcct
gggaaagagcagcaggcattttctgttgagtttcatcacaagagcttcagtgcgacgctg
aatgctggggatgtggcgacttatgtttggcggtaa

DBGET integrated database retrieval system