KEGG   Granulicella tundricola: AciX9_4423Help
Entry
AciX9_4423        CDS       T01411                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
acm  Granulicella tundricola
Pathway
acm00010  Glycolysis / Gluconeogenesis
acm00071  Fatty acid degradation
acm00350  Tyrosine metabolism
acm00625  Chloroalkane and chloroalkene degradation
acm00626  Naphthalene degradation
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01130  Biosynthesis of antibiotics
acm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_4423
  Lipid metabolism
   00071 Fatty acid degradation
    AciX9_4423
  Amino acid metabolism
   00350 Tyrosine metabolism
    AciX9_4423
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciX9_4423
   00626 Naphthalene degradation
    AciX9_4423
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AciX9_4423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C zf-FCS
Motif
Other DBs
NCBI-ProteinID: ADW71371
UniProt: E8X7D7
Position
pACIX903:complement(119513..120505)
Genome map
AA seq 330 aa AA seqDB search
MKAAVYDSKLSSPDRLVEIMEVPRPTPVAGHLLLRVLACGVCRTDLHIVEGDLPALLPRI
IPGHQIVGEVVDVGTVRLPLGTRVGVSWIGGTDGNCWFCRNQMENLCDHPVFTGYSVNGG
YAEFVLVREDFVFPLPGPLDGAQIAPLLCAGIIGFRSLRIAGVLPGERVGLFGFGSSAAL
AIRILQFWKCEVYVVTRGKAHRDSATALGATWVGAEDAGPPVQLDRAITFAPSGKVVIDA
LRCLRKGGVLAVNAIHLDQMPAFDYDKLLWGERQIRSVANMTRDDARDFLELAQQLQFQP
RVTIFSLVDAHKALAAVKNEDESGSIVIVP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgctgtctacgattcaaagctttccagtcctgatcgactggtcgagataatg
gaagtcccgcgcccgacgcctgtggccgggcacctcctcctccgggtacttgcctgcggt
gtctgccgtaccgatctgcacatcgtggaaggagatctgccagccctgttacccaggatc
attccggggcaccagatagtgggagaggttgttgatgttggcactgtccgactaccactt
ggaacgcgggtaggggtctcatggatcggtggcacggatggtaattgctggttctgccgg
aaccaaatggaaaatctctgcgaccatcccgtgttcactggatactcggtgaatggcggg
tatgcggagttcgtgcttgtacgcgaagacttcgtgtttccactgccaggcccgttggac
ggtgctcagatcgctcccctcctttgcgcgggcatcatcggtttccggagcctgcgtatt
gccggagtcttgcctggggagagggtgggcctgttcgggtttggtagttctgcggcgttg
gctattcgcatcttgcagttctggaagtgtgaggtctatgtcgtgacccgcggcaaggct
catcgcgactctgccacagctctcggtgcaacctgggtgggggctgaagatgctggtccg
cccgtccagctcgatcgagccatcacgttcgctcccagcggcaaggtagtgatcgatgct
cttcgttgccttcgcaagggcggagttttggcagtgaacgcgattcatctggaccagatg
cccgcgttcgactatgacaagttgctctggggagaaaggcagatccgcagcgtggcgaac
atgactcgcgacgatgcgcgggatttcctggagttggcgcagcaactccagttccaacct
cgggtaacgatcttttcactcgtcgatgctcacaaggctctcgccgctgtaaagaatgaa
gacgaatcaggttcgatcgtgattgtgccctag

DBGET integrated database retrieval system