KEGG   Granulicella tundricola: AciX9_4446Help
Entry
AciX9_4446        CDS       T01411                                 

Definition
conjugation TrbI family protein
Orthology
K03195  
type IV secretion system protein VirB10
Organism
acm  Granulicella tundricola
Pathway
Bacterial secretion system
Class
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:acm03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pACIX903:143796..145070
Genome map
AA seq 424 aa AA seqDB search
MSETPATVPSQPESNAPIKKGFPILLILVAIVLLVGIANVSHLVSGAKKPVAKSALTSSP
ATVNPQQVSSYQTMQATEIKRDAEDRQVLAANQAAALQAQSDLPGPEADSSAPMTAAQRQ
SIYGDSPNAPRHTSNASQGHAEAQQRELAHRKAQQDAINSDTVAIDFAHAGGTPAAVLGD
REQATNTASGEDIGSAAERPARPATLQTVADTRNSAKGDPMAPYGFDAYQGQLYRVFEGT
VLEGVVTNHIDGGFSGPILVMLTTDYYSHDHQRLLMPQGTRLIGTVQSVGSQGQRKMFVT
FYRAVCPDGFSLEFDKYIGLDPIGTTGLASKVDNHYLSAFGAAAAIGGLGGLAQIGNSAS
VLDPSAQIRNDMSQQTAQEGEQILNHFLNRLPTITLKEGSRARVYIGRDILIPSYADHRV
DPTL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaactcccgccaccgtccccagccagcctgagtcgaatgcccctatcaaaaag
gggttccccattctgctcatcctcgtcgcgattgtcctgctcgtcggcatcgccaatgtc
tctcacctggttagcggagcgaagaagccagtagcgaagagtgccctgacgtccagccca
gccaccgtcaacccgcagcaggtcagcagctaccagaccatgcaggcgaccgaaatcaag
cgcgatgcggaggatcgccaggtacttgccgccaaccaagcagccgctctccaggcgcag
tctgaccttcccggccctgaagccgacagcagtgcgcccatgactgccgcccaacgacag
tcgatctacggagacagccccaacgcaccccgccacacgtccaatgcgtcccagggccac
gctgaagcccagcagcgcgagctcgcgcaccgcaaggcccagcaggatgccatcaacagc
gataccgtagccatcgacttcgcccatgccggcggaactccagccgcagtcctcggcgat
cgcgagcaggcgacaaatacggccagcggtgaagacataggcagcgcagcggagcggccg
gcacgtccggccacactccagacggttgcagacactcgcaacagcgcgaagggcgatccc
atggcaccgtatggtttcgacgcataccagggccagctttaccgcgtgttcgagggaacg
gttctggagggcgtcgtcaccaaccacatcgacggtgggttctcaggacccatcctggtg
atgctcaccacggactactactcccacgatcaccagcgccttctcatgccgcagggtacg
cggctgatcggcacagtgcagagcgtcggcagccaggggcagcggaagatgttcgtcacc
ttttaccgcgccgtctgtccggatgggttctcactggagttcgacaagtacattggcctc
gaccccatcggaacaaccggcctcgccagcaaggtcgataaccactacctctccgccttc
ggcgcagcggccgcgatcggcggactaggcggattggcacagatcggcaacagcgccagc
gttctcgatccgtcagcccagatccgcaacgacatgtctcagcagaccgcacaagagggc
gagcagatcctcaaccacttcctcaaccggctccccaccatcaccttgaaggaaggatct
cgcgccagggtctacatcggccgagacatcctcatcccgtcctacgccgaccatcgcgta
gatccaaccctctaa

DBGET integrated database retrieval system