KEGG   Anaplasma centrale: ACIS_00204Help
Entry
ACIS_00204        CDS       T01133                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acn  Anaplasma centrale
Pathway
acn00010  Glycolysis / Gluconeogenesis
acn00020  Citrate cycle (TCA cycle)
acn00620  Pyruvate metabolism
acn01100  Metabolic pathways
acn01110  Biosynthesis of secondary metabolites
acn01120  Microbial metabolism in diverse environments
acn01130  Biosynthesis of antibiotics
acn01200  Carbon metabolism
Module
acn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIS_00204 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ACIS_00204 (pdhC)
   00620 Pyruvate metabolism
    ACIS_00204 (pdhC)
Enzymes [BR:acn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ACIS_00204 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACZ48882
UniProt: D1ATK4
Position
complement(176325..177620)
Genome map
AA seq 431 aa AA seqDB search
MPVRVLMPALSPTMKSGIVAKWHKKEGDPVKPGDVIADIETDKAVMEFEYVDEPGVLHKI
LTQEGTRDVPVNQVIAVVRVGDEDIGSVDEALCEVGHSATAKGPTAAQEKPATAAPASPC
AASTEKAAQPQLKHQQPKMGVAYPIPDFVEERKIKATPLAKKLAARLSVDITKISGTGPY
GRVVKADILDATSAGSFPSTTDAAGDVVEVSSMRRVIADRLLESKLTVPHFYLAVDCMVG
ELLKLRAEINGSCADRGTRITVNDFVLKAAALAMREFPEINSSWEGDRIRYHRDVNISFA
VSIDGGLITPVVKNVDVKPLSEISDTTKSLTTRAKERKLQPSEFQGGGFTVSNLGMFGVR
EFYAIINPPQSCIMAVGQSEKRAVVVDGCVVPADVMTVTLSVDHRVVDGVLAAKFLNRFK
FYIENPLLMLV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccagttagagtattaatgccagcgctctccccaacaatgaagagcggcattgtggct
aagtggcacaaaaaagagggggatccggtcaagcctggcgatgttatcgcagatatagaa
acggataaggctgtgatggagttcgagtatgtggatgagcccggggttctccacaaaatc
ctcacgcaggaaggcacaagagacgtgccggtcaatcaggttatagccgtagtaagagtg
ggcgacgaagacattgggtccgttgatgaggcactgtgtgaagtcgggcacagcgcaacc
gcaaagggcccaacagctgcgcaggaaaaacctgcaacagcagcaccggctagcccttgt
gcagctagcacagaaaaggctgcgcagcctcaactcaagcatcaacaaccaaaaatgggg
gttgcgtacccgatacctgattttgttgaggagcgtaaaatcaaggcaacaccactggct
aagaaactcgctgctaggctgtcagtggacattaccaaaatctcgggcaccgggccgtat
ggtagggtagtcaaggctgacattttagatgcaacatcggcaggcagctttcccagcaca
acagatgcagcgggtgacgttgtggaggtcagcagcatgcgcagggtaatagctgaccgg
ctactggagtcaaagttgacggtaccgcatttttacctcgcagtggactgcatggtggga
gaactcttgaagcttagggctgaaattaacggcagttgcgccgatcgcggcactaggatc
acggttaacgattttgtgctaaaggcagcagcactggcaatgcgggaattcccagaaatc
aattcttcgtgggagggtgacaggataaggtaccatagagacgtcaacatatcgttcgca
gtctcaatagacggagggctaatcactcccgttgttaaaaacgttgacgtgaagccccta
tcagagatatccgacaccacaaagagcctaaccaccagggctaaagagaggaagttgcag
cctagcgaattccaggggggtgggttcaccgtatccaatttgggaatgtttggagtacgc
gagttctacgcaatcataaatccccctcagtcttgcataatggctgtagggcaatccgaa
aagcgtgcggtcgttgtggatggctgcgttgtgcccgctgacgttatgacggtcacgctt
tcagtggaccacagggtagtggatggggtgttggcagcgaagtttttaaacagattcaag
ttttacatcgagaacccgttgctgatgttggtgtag

DBGET integrated database retrieval system