KEGG   Anaplasma centrale: ACIS_00275Help
Entry
ACIS_00275        CDS       T01133                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acn  Anaplasma centrale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACIS_00275
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIS_00275
  Amino acid metabolism
   00310 Lysine degradation
    ACIS_00275
Enzymes [BR:acn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACIS_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252238..253482
Genome map
AA seq 414 aa AA seqDB search
MSDNVEIKVDNLGGESISEAPVRVLKRVGDAVSAEEAVFVIETDKTSLEIASPVAGVITE
LRVSDEEIITRGQVLAIISKHEGAPQDAAAREHKQAEVAAPDAELAPQVEQRDVQVQVAD
KEKPVKPATGPRIPGIDEFVAGGCSSPADRAAGKITKPVGDVGKSPVPQQRVYDEVDGII
SVPGERRVKMSKIRQVIASRLKESQNTAATLSTFNEVDMSAVMALRGKYKEGFEKKYEVK
LGFMSFFIRAVVLALREIPVINAEISGDEIIYRDYCNIGVAVGTDKGLVVPVIRGAETMS
FAALEQELVMLSKKARGGTLTVADMSGATFTITNGGVYGSLLSTPIINPPQSGILGMHAI
QERPVVVNGNIEIRPMMYLALSYDHRIVDGQGAVTFLVRVKQYIEDPNRMSLEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataatgtagagataaaagttgataaccttggtggggaatccatatcagaggcc
cctgttcgggttctgaaaagggttggtgatgccgtttccgcagaagaggcggtttttgtt
attgaaacggataaaacctctctggagatagcgtctccggttgccggtgttatcaccgaa
ctgcgcgtgtcggacgaagagataataaccaggggccaggttttggcgatcatcagcaag
catgaaggtgcccctcaggatgccgcagcgcgtgagcacaagcaagctgaagttgcagct
ccggatgccgaattagcaccgcaggttgagcaacgtgatgtgcaagttcaagttgctgac
aaggaaaagccggttaagccagccactggcccacgcattcccggtatagacgagttcgtt
gccggtgggtgttcctcacctgctgatagggcggctggtaaaatcaccaagcctgtgggc
gatgtgggcaagagccccgtcccgcagcaacgcgtgtatgatgaggttgacggcatcata
agcgtgccaggggaaaggcgcgttaagatgagcaaaatccgccaggtgatcgcgtcacgg
ctgaaggaatcgcaaaacaccgcagccacgctcagcacttttaatgaggtggatatgagt
gctgttatggcgctcagggggaaatataaggaaggctttgagaagaagtatgaggtgaaa
ctggggttcatgtcgttcttcatcagggccgtggtgctggctctcagagagataccggtg
attaatgctgagatttccggggatgagataatataccgtgactactgcaacatcggggtc
gcggttggcacggataaggggttagtagttccggtgatacgcggggccgagacaatgtcg
tttgcggcgttagagcaagagttggtaatgctgagtaaaaaggccaggggagggacgctc
acagttgctgatatgtctggcgcaacgtttaccatcaccaatgggggggtgtatgggtct
cttctttccacaccgattatcaaccctcctcagtcagggattctgggcatgcatgcaata
caagagcgccccgtggtggtcaacggcaatattgaaatcaggcccatgatgtatctcgcg
ctttcgtatgaccacagaatagtggatggtcaaggtgcggtgaccttcctcgtgcgcgtc
aagcaatatatagaagatccgaacaggatgtctctcgagatttag

DBGET integrated database retrieval system