KEGG   Anaplasma centrale: ACIS_00365Help
Entry
ACIS_00365        CDS       T01133                                 

Definition
pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acn  Anaplasma centrale
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACIS_00365
Enzymes [BR:acn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ACIS_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342839..343453)
Genome map
AA seq 204 aa AA seqDB search
MDIWGQCVRWQAQKSLAKISRQCNNALHVPTNNGNVDVVVLALGSNVGSRKNNLEAAVRL
LPIYNGHCSYIYETRALLPDGAPTWWDMPYLNMVMCGYVNLSPDELLGCIKRVEYTLGRS
NTGTWGPRPIDVDILLYDGLSMQSDTLTIPHKEMHKRDFVLVPACDVCARFPHTVLKTTL
ETILSSMQEVDVVRKYSPLSCTRT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtggacatatggggccaatgcgttagatggcaagctcaaaaatcactcgctaaaatttcg
cggcaatgcaacaatgccttgcatgttccaacaaacaacggaaatgtagacgtggtggtg
ctggcactgggtagcaacgttggctcgagaaagaacaatttagaggctgctgtcaggttg
ctccccatctacaacgggcattgttcgtacatatacgaaaccagagctttgctaccggat
ggggcacctacttggtgggacatgccgtacctcaacatggtaatgtgtggctacgtaaat
ctgtctccagatgagctgctggggtgcataaagcgcgtggagtatactttgggaagaagc
aacactgggacatggggtccaagacctatagatgtggacatactactgtacgatggcctg
tcgatgcagagtgacaccctcactataccgcacaaagagatgcacaaaagagatttcgtc
ctcgtaccagcatgcgatgtctgcgctaggttcccccatactgtgctcaaaaccacgcta
gaaactattctatcgtcaatgcaggaagtagatgtggtaagaaagtacagcccgctgagc
tgcacccgcacgtag

DBGET integrated database retrieval system