KEGG   Anaplasma centrale: ACIS_00505Help
Entry
ACIS_00505        CDS       T01133                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen 3 synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acn  Anaplasma centrale
Pathway
acn00860  Porphyrin and chlorophyll metabolism
acn01100  Metabolic pathways
acn01110  Biosynthesis of secondary metabolites
acn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACIS_00505 (hemD)
Enzymes [BR:acn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ACIS_00505 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 HypD
Motif
Other DBs
NCBI-ProteinID: ACZ49124
UniProt: D1AU96
Position
464186..464893
Genome map
AA seq 235 aa AA seqDB search
MGMLVLTRASADSAKSKGALEELGFDVFVEPMFEVVHLRTEALKLQSYDVTVVTSRNGVD
VIAKLTDERDICILTVGDSTMKRATALGFTNVVSAGGTVRDVVSCLNAYQRGTKVLYARG
EEVSYDLRGAAEKMGFEVEEAVLYKVVARANLSPQCCDLLMNGEILGVVFYSTRTAKIFT
ELSRQYSRLLRNVCAYSMSSGVFRALDVGAWKRILVSRRPTEESLFKLLLGIERS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgctggtgttgacccgtgccagtgcagactcagcaaagtccaaaggggctctg
gaggaattggggttcgacgtttttgttgagcccatgtttgaagttgtgcatctgcgtact
gaggccctaaagttgcagtcatatgacgtcactgttgttacgagcaggaatggtgttgat
gttattgccaagcttaccgatgaacgtgatatctgcatattaactgtgggtgacagcacc
atgaagcgtgcgactgctcttgggtttactaatgtggtatctgcgggtggcaccgtgcgc
gatgtagtatcttgcctgaatgcgtaccaacgcggaaccaaggtgctatacgcgagaggg
gaggaagtttcatacgatttgcgcggtgctgcagagaaaatgggttttgaggtagaagag
gctgtgctctacaaggttgtagctagagcgaatctgagcccccagtgctgtgatctgctc
atgaatggtgagatattgggtgtggttttttactcaactaggacggccaagatttttacc
gagttatccagacaatacagcaggcttctgcgtaatgtttgtgcgtattctatgagcagc
ggggtttttcgcgcactggatgtgggtgcgtggaagcggatacttgtttctcgacgcccc
actgaggagtcattgtttaagttattgttaggcattgaaagatcataa

DBGET integrated database retrieval system