KEGG   Anaplasma centrale: ACIS_00695Help
Entry
ACIS_00695        CDS       T01133                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
acn  Anaplasma centrale
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679115..679708
Genome map
AA seq 197 aa AA seqDB search
MHKDLHKPSDEDAKEAVEVLIRWIGDSPGREGLSLTAGRVLNTYRESFRGYALESLHDFR
NSVFVNEGYSDMILLRGVNFSSTCEHHMAPMTGVANISYIPKAAVLGVGAIIRVIDIFTK
RLQLQERMTVQIAHFLSELLKPAGVAVLIEARHWCAKCSGGEAVDDLKLQTSCMLGAFQD
DHNVRSEFFCRVGCKFS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaggatttgcacaagccttctgatgaggacgctaaggaggcggttgaggtccta
ataaggtggattggtgattcccccggcagggagggtttgtccttaacagctggcagggtt
cttaacacttacagggagtctttccggggatatgcgcttgagtcactgcatgactttcgc
aattctgtgtttgtaaatgagggctattccgatatgatactgctgcgaggggtgaatttt
tcttccacttgtgagcatcacatggctccgatgactggggtggcgaatatttcatatatc
cctaaggctgccgtgcttggagttggtgccataatcagggtaatagatatctttaccaag
cgtctgcagttgcaagaacgcatgactgttcaaattgcacactttttgagtgagctccta
aagcctgctggtgtggctgtgttgattgaagcaaggcactggtgcgcgaagtgctcaggg
ggagaggctgtcgatgatctcaagttgcagaccagttgcatgcttggtgcatttcaggat
gaccacaatgtgcgtagcgagtttttttgtagagtagggtgtaagttttcgtag

DBGET integrated database retrieval system