KEGG   Anaplasma centrale: ACIS_00750Help
Entry
ACIS_00750        CDS       T01133                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acn  Anaplasma centrale
Pathway
acn00010  Glycolysis / Gluconeogenesis
acn00051  Fructose and mannose metabolism
acn00562  Inositol phosphate metabolism
acn01100  Metabolic pathways
acn01110  Biosynthesis of secondary metabolites
acn01120  Microbial metabolism in diverse environments
acn01130  Biosynthesis of antibiotics
acn01200  Carbon metabolism
acn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIS_00750 (tpiA)
   00051 Fructose and mannose metabolism
    ACIS_00750 (tpiA)
   00562 Inositol phosphate metabolism
    ACIS_00750 (tpiA)
Enzymes [BR:acn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACIS_00750 (tpiA)
Exosome [BR:acn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACIS_00750 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACIS_00750 (tpiA)
  Exosomal proteins of melanoma cells
   ACIS_00750 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACZ49306
UniProt: D1AS53
Position
complement(721732..722466)
Genome map
AA seq 244 aa AA seqDB search
MELMSFLVVANWKMNGSVALVRDFLSAIDASFAPDLLSKHSLELVICPPFTVMSAFNSGC
PSVKLGAQNCFSGASKGATGEISAKMLRECGCDYVILGHSDRRSAFGEGNSDIRLKAESA
IGEGITPIICVGETLQERHSGMSGDVLVEQCDECCPKYGEFIIAYEPVWAIGGSTIPDLG
IIKESFDIIASHSSVRTVLYGGSVNQDNIRALKSQVGSLSGVLVGSAGTRVEAFCGIISS
VLEL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttatgtcctttcttgttgtagctaactggaagatgaatgggagcgtcgccttg
gtgcgggattttctctccgcgattgatgccagctttgcaccagacctgctcagcaagcac
tctcttgagttggttatatgccctccgtttactgtgatgtcggcattcaattctggatgt
ccgtcggtaaagcttggcgcacagaactgcttttctggggctagtaagggtgctacgggt
gagataagcgctaaaatgttaagggaatgtggctgtgactacgtcattcttgggcattct
gataggcgaagtgcatttggtgaaggaaattcagacattaggttaaaggctgaatccgcc
ataggggaggggattacacctataatctgtgtgggtgaaacacttcaggagaggcacagt
ggtatgtctggcgatgtgctggtggaacaatgcgacgagtgctgcccaaaatatggagag
tttattattgcgtatgagccggtttgggccataggcggttcaaccattcccgatttaggg
ataataaaagaatctttcgatataatcgcgtctcatagttctgtacgtaccgtgctttac
ggtggctccgtgaaccaagataatatacgtgctctaaagtcgcaagttggcagcctatct
ggggtgttggttggaagcgcaggaacgagagtcgaggcgttttgcggaattataagcagt
gtgttggaattgtag

DBGET integrated database retrieval system