KEGG   Anaplasma centrale: ACIS_00750Help
Entry
ACIS_00750        CDS       T01133                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acn  Anaplasma centrale
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACIS_00750 (tpiA)
   01230 Biosynthesis of amino acids
    ACIS_00750 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIS_00750 (tpiA)
   00051 Fructose and mannose metabolism
    ACIS_00750 (tpiA)
   00562 Inositol phosphate metabolism
    ACIS_00750 (tpiA)
Enzymes [BR:acn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACIS_00750 (tpiA)
Exosome [BR:acn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACIS_00750 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACIS_00750 (tpiA)
  Exosomal proteins of melanoma cells
   ACIS_00750 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(721732..722466)
Genome map
AA seq 244 aa AA seqDB search
MELMSFLVVANWKMNGSVALVRDFLSAIDASFAPDLLSKHSLELVICPPFTVMSAFNSGC
PSVKLGAQNCFSGASKGATGEISAKMLRECGCDYVILGHSDRRSAFGEGNSDIRLKAESA
IGEGITPIICVGETLQERHSGMSGDVLVEQCDECCPKYGEFIIAYEPVWAIGGSTIPDLG
IIKESFDIIASHSSVRTVLYGGSVNQDNIRALKSQVGSLSGVLVGSAGTRVEAFCGIISS
VLEL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttatgtcctttcttgttgtagctaactggaagatgaatgggagcgtcgccttg
gtgcgggattttctctccgcgattgatgccagctttgcaccagacctgctcagcaagcac
tctcttgagttggttatatgccctccgtttactgtgatgtcggcattcaattctggatgt
ccgtcggtaaagcttggcgcacagaactgcttttctggggctagtaagggtgctacgggt
gagataagcgctaaaatgttaagggaatgtggctgtgactacgtcattcttgggcattct
gataggcgaagtgcatttggtgaaggaaattcagacattaggttaaaggctgaatccgcc
ataggggaggggattacacctataatctgtgtgggtgaaacacttcaggagaggcacagt
ggtatgtctggcgatgtgctggtggaacaatgcgacgagtgctgcccaaaatatggagag
tttattattgcgtatgagccggtttgggccataggcggttcaaccattcccgatttaggg
ataataaaagaatctttcgatataatcgcgtctcatagttctgtacgtaccgtgctttac
ggtggctccgtgaaccaagataatatacgtgctctaaagtcgcaagttggcagcctatct
ggggtgttggttggaagcgcaggaacgagagtcgaggcgttttgcggaattataagcagt
gtgttggaattgtag

DBGET integrated database retrieval system