KEGG   Anaplasma centrale: ACIS_00872Help
Entry
ACIS_00872        CDS       T01133                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
acn  Anaplasma centrale
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acn00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:acn00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854673..856055)
Genome map
AA seq 460 aa AA seqDB search
MESSLLKIKHRTLSSVARVVGEVTDVVMSWVGNISSDLARSQDMDKLLGKMQECVSPKGG
EVKARHNTISLGNLYLHLSDVGKAKFLRMLNDQFNSSKEDINRKISAYVNNSNAELEEKL
KFELISVLLSPRLAILRQFMSLSEGVKFLVDMRADVVTLIRKGEDFFALERDLKSVLSSL
FDVGLLDLHQITWDSPASLLEKLIFYEAVHAISSWDDLHYRLDSDRRCFAFFHYKMPGEP
LIFVEVALVDTVADNVQALLDGSIPKKDPADAKVAVFYSISNTQVGLSGINLGNFLIKRV
VERLSCEFRNIKTYVTLSPVPGFVQWLKSLTRDEVVILQKLGITHTLGEVQSLVGKVSKY
GSFALPIQEMFLKLCAHYLVNEKKGNRVLDQVAHFHLSNGASVKRLNWMADKSEKGLACS
MGIMVNYYYEIAKIDDNHESYVVHGKVIASKEVSALLKKG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagctcgttgctcaagataaagcatagaacacttagcagtgtggcaagggtcgtc
ggtgaggtgaccgatgttgtcatgtcctgggttggcaacataagtagcgatcttgccaga
agccaggatatggacaagcttcttgggaaaatgcaggagtgtgttagcccgaagggtggg
gaagttaaggcgaggcacaatactatatcccttggaaatctctacctgcacctgtctgat
gtgggcaaggccaagtttctgcgtatgttgaatgaccagttcaactccagtaaggaagat
ataaaccgcaagatcagtgcatatgtaaacaatagtaacgcagagctcgaggaaaaactt
aagttcgagctcatctcagttttgctctctcccaggttggccattcttaggcagtttatg
tctctgtcggagggagtgaaatttcttgtagatatgcgggccgatgtggttacgctaatc
agaaagggagaagattttttcgcgcttgaaagagatttaaagagtgtactgtcttcgctg
tttgatgttggcttgttagatttgcatcaaataacctgggattctccggcatcactactg
gaaaagctaatattctacgaggcggtgcatgcaatatcctcctgggatgatctgcactac
aggttggattccgaccgtcggtgtttcgcattttttcactacaaaatgccgggggagccg
ctgatatttgtggaagttgccttggttgacactgtggcggacaacgtgcaggcactgctg
gatggcagcatccctaagaaagatcctgccgatgccaaggttgcggttttctactcgatc
tcaaatactcaagttggtctgagtgggattaatctgggaaattttttgatcaaaagagtg
gttgagaggctttcttgcgagtttcgcaatataaagacctacgtgacgctctctcccgtg
cctgggtttgtgcagtggctcaagagcctgactcgggatgaggtggttatactacaaaaa
ttgggcattacgcacactcttggtgaggtacaatcacttgtgggcaaggtcagtaagtat
gggagctttgctctaccaatacaggaaatgttcctaaaattgtgcgcccattacctggtc
aatgaaaagaagggcaacagagtattagaccaggtcgcgcactttcacctcagcaatggc
gcgtcggttaagcggctaaactggatggctgataagtcagaaaagggactagcgtgttcc
atgggcattatggtaaattactactacgagattgccaaaattgatgacaatcatgagtcg
tacgttgtgcacgggaaggtgattgcttccaaggaagtgtcggccttgttgaaaaagggt
tga

DBGET integrated database retrieval system