KEGG   Anaplasma centrale: ACIS_00907Help
Entry
ACIS_00907        CDS       T01133                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
acn  Anaplasma centrale
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891866..892453)
Genome map
AA seq 195 aa AA seqDB search
MDITKLINLFAKLPSLGPASSRRIVLHLLRHRQDVMVPLAAGIRELEMHTKECTICHNLD
TISPCSICSDKGRDQSIICVVEELGDLWAFERGRIYSGVYHVLGGALSALSGIGPEDLNL
GGIVDRIRTHGVKEVIVATSNDMDGQVTCHYIAQMVKGTDAKVTRLACGIPLGGEIDYLD
EGTLRAALSSRYVIT
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggacataactaagcttataaatctttttgccaagcttccgagtttgggccctgcctct
tcacgtcgcatagtgttgcatctgttgcggcataggcaggacgtaatggtgcccctcgct
gccggaattagagagttagaaatgcacactaaggagtgcacaatctgccacaatttagac
accatttctccctgctccatatgttccgataagggtcgggaccaaagcattatctgtgtt
gttgaggagttgggtgacttgtgggctttcgagcgcgggagaatatattccggggtatac
cacgtgctggggggagcattgtctgccctctctggtattggcccggaagacctaaatctg
ggtggaattgtagataggattcgcacgcatggggttaaagaagtcatcgttgcaacgagc
aatgacatggacggacaagtgacgtgccattacatagctcagatggtgaagggcactgat
gccaaggtgactaggcttgcatgtggcattcctcttgggggagagatagactacctagat
gagggcacgctacgcgcggctctctcctcaaggtacgtcattacctag

DBGET integrated database retrieval system