KEGG   Anaplasma centrale: ACIS_01004Help
Entry
ACIS_01004        CDS       T01133                                 

Gene name
sdhD
Definition
succinate dehydrogenase SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
acn  Anaplasma centrale
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:acn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:acn00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:acn00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1001115..1001471)
Genome map
AA seq 118 aa AA seqDB search
MVVALALMGGRSVYFWWMQRIAGLVMLPVPFLFVFFYRSYGFESVYAADYGFCASISGIA
LLVAAFYHGVLGVQVVLEDYVQSEVARAFMVTFFRLFSAVTIGAVVLALFFGHGVGGS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtagctctggctcttatgggtggaaggtcggtatatttttggtggatgcaaaga
atagccgggctggttatgctacccgtgccgtttctgtttgtgtttttctaccgctcttac
ggttttgaatctgtttatgccgctgactatggcttttgtgccagcatatccggtatcgcg
cttcttgttgctgcgttttatcatggggtgctgggtgtgcaggtagttctggaggattac
gttcagtctgaagttgcgcgtgcctttatggtcacgtttttcaggctgttttccgcggtg
actataggcgcagtggttttggcattgttttttgggcacggtgtagggggaagctag

DBGET integrated database retrieval system