KEGG   Anaplasma centrale: ACIS_01004Help
Entry
ACIS_01004        CDS       T01133                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
acn  Anaplasma centrale
Pathway
acn00020  Citrate cycle (TCA cycle)
acn00190  Oxidative phosphorylation
acn00650  Butanoate metabolism
acn01100  Metabolic pathways
acn01110  Biosynthesis of secondary metabolites
acn01120  Microbial metabolism in diverse environments
acn01130  Biosynthesis of antibiotics
acn01200  Carbon metabolism
Module
acn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIS_01004 (sdhD)
   00650 Butanoate metabolism
    ACIS_01004 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ACIS_01004 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACZ49493
UniProt: D1ASP0
Position
complement(1001115..1001471)
Genome map
AA seq 118 aa AA seqDB search
MVVALALMGGRSVYFWWMQRIAGLVMLPVPFLFVFFYRSYGFESVYAADYGFCASISGIA
LLVAAFYHGVLGVQVVLEDYVQSEVARAFMVTFFRLFSAVTIGAVVLALFFGHGVGGS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtagctctggctcttatgggtggaaggtcggtatatttttggtggatgcaaaga
atagccgggctggttatgctacccgtgccgtttctgtttgtgtttttctaccgctcttac
ggttttgaatctgtttatgccgctgactatggcttttgtgccagcatatccggtatcgcg
cttcttgttgctgcgttttatcatggggtgctgggtgtgcaggtagttctggaggattac
gttcagtctgaagttgcgcgtgcctttatggtcacgtttttcaggctgttttccgcggtg
actataggcgcagtggttttggcattgttttttgggcacggtgtagggggaagctag

DBGET integrated database retrieval system