KEGG   Anaplasma centrale: ACIS_01012Help
Entry
ACIS_01012        CDS       T01133                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate 2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
acn  Anaplasma centrale
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:acn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010825..1012294
Genome map
AA seq 489 aa AA seqDB search
MFYSPPEIAIINLMYIDGIVRKLVNQVSGITADSRNVKPGFVFVCLSEVAKKFVSDAVKA
GARFIVAGSAEALPRVDNAQIIIFPKQHDFYYKLASAFYRGRQPEFVAAVTGTNGKTSVA
DFCRQIWHLTGNTGASIGTLGTAVGGIVTPYGSTLLTTPDAMELHKTLSELYNSHVKYLC
IEASSHGMAQKRLYGVKVSVAAFTNLSRDHSDYHGGMEKYWAAKRKLFSEVLSHEGCAVL
NADSGRYAELRRLVGSRNTITYGINVGDVRLTRLKSSTLGHNVAVEICGKVVYDGAFPVL
GKFQIPNLLCALAIVTASGARCSDIPIDKLVSPRGRMELIGGRVIVDYAHTPAALEHALT
SLKWHGFPQKIVLVFGCGGDRDREKRGAMGMVAGKYADVIIVTDDNPRNENPEAIRKEIL
SHCERAIEIPNRSDAIHYAVNFAVRNDHMLLIAGKGHETTQQIAGESIEFNDGDVVRSCL
RAMQGAYAD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttttactcccccccggaaatcgccattataaaccttatgtacattgacggcattgtc
aggaaactggtcaaccaagtttctggaatcacagctgattcaagaaacgtgaagcctggt
ttcgtctttgtgtgtctgtcagaagttgcaaaaaagttcgtgtcggacgcggtcaaggcc
ggtgcgaggtttatagtagctggcagcgctgaagcgttaccacgtgtggacaacgcgcag
ataataattttcccaaagcagcatgatttttattataagttggcttctgcattttaccgc
ggtaggcagcctgagttcgtcgcagcagtaacgggtacaaacggaaagacttctgtggca
gatttctgtaggcaaatttggcacctaaccgggaacacaggagctagcattggtacccta
ggtaccgcagtaggcggtattgtgaccccatatggcagtactttacttacaacgcctgac
gcaatggagctacacaaaacgttgagtgagctatacaactctcacgtcaagtacctgtgc
atagaagcctcaagtcacggcatggcgcaaaagcgtctgtacggagttaaagtcagtgtc
gcggcatttacgaacctctcccgcgaccattcagattaccacggcggcatggagaaatac
tgggccgcaaaacgaaaattattctcggaggtgctgtcacatgaggggtgtgcggtgctg
aacgcagattcggggcggtatgccgaactgagaaggttggtagggagccgcaacacaatc
acctacggtataaacgtgggtgacgtgaggttaacgcgcctgaaaagcagcacgttgggg
cacaacgtggcggtggaaatatgtggcaaagtggtatacgatggagcattcccagttttg
ggaaaatttcagataccaaacttgctctgcgcactggccatagtaaccgcttcgggggcc
aggtgtagcgacatacccatcgataagttggtctccccgagggggcgcatggagctgata
ggtggccgcgtaattgtggattacgcgcacacacccgcggctctggagcatgccttaact
tcactaaagtggcatgggttccctcaaaagatagtgttagtattcggatgcggaggcgac
cgagatcgggagaagcgcggggccatgggcatggtggccggcaagtatgccgacgtgatt
atcgtgacggatgacaatccacgaaatgaaaatccggaggcaatacgaaaagagattctg
tcgcattgcgagcgggcgattgaaattccgaataggagcgatgcaatccactatgcagtc
aattttgcagtccgtaacgatcacatgctcctgatagccggcaaggggcatgaaaccacc
cagcaaattgcgggcgagtcgatagaatttaacgatggggacgtggttaggagctgtttg
cgcgctatgcagggggcatatgccgattag

DBGET integrated database retrieval system