KEGG   Anaplasma centrale: ACIS_01090Help
Entry
ACIS_01090        CDS       T01133                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
acn  Anaplasma centrale
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACIS_01090 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACIS_01090 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088553..1089092
Genome map
AA seq 179 aa AA seqDB search
MGVGFRFNRVATAILLASFVILLVSNVVDLLYNPDEDPPRGYSVDVGSKQPAATDAGAGD
AQQEVDLASLMSNASPDRGKSVSKKCVACHTFDKGGPNRVGPNLWGIIGAKKCNTPGFTY
SKALSSTQGDWSEEELFKFLKSPQSYASGTRMSFVGLSKPQDIADLLAYMKQLKQQEGE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgtgggtttcaggttcaatagagttgccactgccatcttgttggcgtccttcgtg
atattattggtgagcaacgtagttgatctgctctataaccccgacgaagacccgcccaga
gggtacagcgtagatgttggcagtaagcagcctgccgctacggacgcgggagcgggtgat
gcccagcaagaggtagatttagcatctctgatgtcaaacgccagcccggatagggggaag
agcgtatccaaaaagtgcgtcgcgtgccacacctttgacaaaggcggccccaacagagta
ggccccaacctgtggggcattataggtgcaaaaaagtgcaacacccccgggttcacatac
tctaaggcgttgtctagcacgcagggcgactggagtgaggaagagttatttaaattcctc
aaaagcccacagagctatgccagcggaactcgtatgtccttcgtgggcctttcaaaaccc
caagatatcgcagatctgcttgcgtatatgaagcagcttaagcagcaggaaggcgaatag

DBGET integrated database retrieval system