KEGG   Anaplasma centrale: ACIS_01103Help
Entry
ACIS_01103        CDS       T01133                                 

Gene name
ruvA
Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acn  Anaplasma centrale
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103654..1104226
Genome map
AA seq 190 aa AA seqDB search
MIGTLSGTVEEVVCSNRIILCVGGVGYLVQLPGRVLSGCQHGDHVRLYIETYVGRDGVSQ
LYGFANREEQNCMRMLIKVSGVNYKTAMAILDVLTPEQVFSAIVSEDRAALKVGGVGEKL
ISRIISELTPQVQKFELNRFAATTRTDSEAVAALLSLGYERTAALGALQKVGVCDSTEDA
VRRALLELSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggacgttgtctggcacggtcgaagaggttgtgtgcagcaatcgcatcatactg
tgtgtcggcggagtggggtatttggtgcagctgccgggcagggtgctaagcggctgccaa
cacggagatcatgttcggctgtatattgaaacctatgtgggcagagacggcgtctcccag
ctctatggctttgcaaacagggaagagcaaaactgcatgcggatgcttattaaagtcagc
ggcgtgaactacaagactgccatggcaatattggacgtgctgaccccagagcaggtgttt
tctgcaatcgtaagcgaagatagggctgctttaaaggttggtggcgtgggagaaaagctc
atcagtagaataatttccgagttgaccccgcaggtacagaaatttgagctcaacaggttc
gctgcaaccactagaacagacagtgaggctgttgctgccttactcagcctggggtacgaa
aggacggcagccttgggtgcgctgcagaaagttggagtgtgtgactccaccgaggatgcg
gtacgccgcgcacttttggagttatctaagtga

DBGET integrated database retrieval system