KEGG   Aminobacterium colombiense: Amico_0234Help
Entry
Amico_0234        CDS       T01202                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aco  Aminobacterium colombiense
Pathway
aco00500  Starch and sucrose metabolism
aco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amico_0234
Enzymes [BR:aco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Amico_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ADE56380
JGI: Amico_0234
UniProt: D5ECU8
Position
complement(247325..248818)
Genome map
AA seq 497 aa AA seqDB search
MIRQSGILLPVFSLPSPWAIGDIGARARNFVDWLAAAGQNCWQMLPLTCTKEILGNSPYD
SISAFACSPLLISIEDLAEEELISNKEISSLNRVSSGRVDYSAAKKIKMPLLKKAFQRFM
SRTNTDPLYRFWEGQSWWLDDFSLFSAISCRMGDDRWNTWPSSLKIRDKVALDTVRTEEK
DHILFTVFIQYEAFTQIQRLRKHSLDRGIQLIGDLPIYVSYESADVWSHPEMFQLDRDLT
PKAVAGVPPDYFSSTGQRWGNPLYRWDYAKGMEFHWWLKRIAHSLQLYDMTRLDHFRGFL
EYWAIPYTEKTAIYGRWEEGPGDSFFSALEKNFPSMPFLAENLGIITPDITRAMKKYDLP
GMLVLLFAFDESMPRNPYILHNHEPRNIVYTGTHDNNTVRGWFDDEGSPQDKERVSRYMN
MPFTRDNAATVLTRMALMSVAERAVIPLQDYLNIGGEGRINKPSTLEGNWQWMAEEKALT
EDLASSLHSLMKTYGRL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatcagacaaagcggaattttactgccggttttttctcttccttccccatgggctatt
ggtgacattggagcaagggccagaaattttgttgactggcttgcagctgccggacaaaac
tgttggcaaatgcttccattgacgtgtactaaagaaattctcggaaactcgccttatgac
agcatttctgccttcgcatgctccccccttctcatcagcattgaagatttagcagaagaa
gaactcataagcaacaaggaaatctcctcccttaacagagtttcttctgggagagttgat
tattctgccgctaaaaaaatcaagatgccccttctaaaaaaggcctttcaacgttttatg
agtagaacaaatacagaccctctctatcgtttttgggaaggacagtcatggtggcttgat
gatttttctcttttttcagctataagctgccgcatgggtgacgataggtggaacacgtgg
ccctcatcccttaagattagggataaagtcgctcttgacactgttagaacagaagaaaaa
gatcatattctctttaccgtctttattcaatatgaagcctttactcagattcagcggttg
cggaaacatagcctggatcgtggaatacagctcatcggcgaccttcccatttatgtcagc
tatgaaagtgctgatgtgtggagtcaccctgaaatgtttcaactagacagagatctgaca
cccaaggctgttgcgggcgtcccccctgattattttagttctaccggacaacggtgggga
aaccccctctaccgatgggattatgccaaaggaatggaatttcactggtggctcaaaagg
atcgctcactccctgcaattatatgacatgacacgtcttgatcattttcgaggttttctg
gagtattgggcaattccttatacagaaaagaccgctatttatggaagatgggaggaaggc
cctggcgattcctttttctcagcccttgaaaaaaactttccttcaatgccttttctcgca
gagaatcttggtattattacgccagatataacccgcgccatgaagaaatacgatcttccc
ggcatgctcgttctacttttcgcctttgatgaatcaatgccccgcaatccttacatttta
cataaccacgagcctcgcaacattgtttatactggaacccatgataacaacactgtacgg
ggatggttcgacgatgaagggtctccccaggataaggaaagggtaagccgctatatgaac
atgccttttacccgagataatgccgcgaccgtcctgaccagaatggcccttatgtcagtg
gcagaacgagccgtaatacctcttcaggactatctcaacattggaggcgaggggcggatc
aacaaaccttccacattagaagggaactggcaatggatggctgaagaaaaggcgcttact
gaagatcttgcttcatctcttcattctcttatgaaaacttatggaagattatga

DBGET integrated database retrieval system