KEGG   Aminobacterium colombiense: Amico_0235Help
Entry
Amico_0235        CDS       T01202                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aco  Aminobacterium colombiense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amico_0235
Enzymes [BR:aco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Amico_0235
Exosome [BR:aco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amico_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
248928..250829
Genome map
AA seq 633 aa AA seqDB search
MKNFKVCPSLFSDLDTYLFKEGTHLKLYEKMGAHPLCSGETQGVYFALWAPNASQVSVIG
DFNLWNPEAAPLSCRPDESGIWEGFVSSAFIGDRYKYRVVSKRGEAFDKGDPFAFAWEEL
PGTASIIASLHYQWNDHLWAEKRKKTNWFSYPLSIYEVHLGSWMRKEGKFLSYREIAEQL
TCYVKKMGFTAVEIMPLMEHPFYGSWGYQITGFFAPTSRYGSPQDLMFLIDTLHQADIAV
FLDWVPSHFPSDEHGLAYLDGTALFEHADPRQKIHPEWRSYIFNYGRTEVREFLINSALF
WLDYYHVDGLRFDGVASMLYLDYARKEGEWVPNRYGGRENIEAVSFLRRLNEAAHLCFPH
IVTIAEESSAWPLVTRPSYVGGLGFGMKWNMGWMHDILKYMELDPLYRQYHHNDLTFSLM
YAFSENYVLPFSHDEVVYGKRSLLEKMPGTLWQKFAQLRLLLGFMYAHPGKKLLFMGSDI
AQRAEWNHEESLHWNLLKDPFHSGMQLWVRDINRVYFEEKALHEKDFSSEGFQWIDCSDS
KASVLGFIRRDGEEGKVLAIFNFTPVVRHNYLVGVPEAGYWRELLNSDGEIYGGMGEGNM
GGKEAMEEPLQRQPCCLSLTLPSFGALFFRKEG
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactttaaagtttgtccgtctcttttttcagaccttgacacgtacctctttaaa
gaaggaacccatctcaaattgtacgaaaaaatgggtgctcacccgttatgcagtggcgaa
acacaaggggtttactttgctctctgggctcctaacgcatcccaggtttctgttatcggt
gattttaatctgtggaatcctgaggcagccccgttgtcttgccggcctgatgaaagcggt
atttgggaaggatttgtttcgtccgcttttataggggaccgttataaataccgtgttgtt
tcaaagagaggggaagcttttgataaaggagatccctttgctttcgcctgggaggaactt
ccaggcacggcatctattattgcatcccttcattatcaatggaacgatcatttatgggca
gaaaaaaggaagaagacgaattggttttcttaccctctttctatatacgaagttcattta
ggttcctggatgagaaaagaaggaaagttcctttcctatcgggaaatagcagaacagttg
acctgttatgtgaaaaaaatgggatttacggccgtagagattatgcctctgatggagcac
cctttttatggctcctgggggtatcagataacaggtttttttgctcctacaagccgttac
ggttctcctcaggatctcatgttccttatcgacactcttcatcaggccgatatcgctgtt
tttcttgattgggtgccctcccatttcccctcagatgagcatggtcttgcttatttagat
ggaacggctttattcgaacatgctgatccgcgccagaagatacatcctgaatggcgaagc
tatatcttcaattatggtcgtacggaagtccgtgagtttctcatcaatagcgcccttttc
tggcttgactactatcatgtggatggccttcgctttgatggtgtggcctctatgctctac
cttgattatgcaagaaaagagggggagtgggtacccaacaggtacggaggccgtgaaaac
atagaggccgtgtcttttctcaggcgcctcaacgaagcggcacatctctgtttcccccat
atcgttacaatagcggaggaatcctctgcatggccgcttgttacccgcccctcctacgtg
ggcggactgggatttgggatgaagtggaatatgggctggatgcacgatatattgaaatac
atggaacttgatccattgtaccgtcagtatcatcataacgatcttacttttagtcttatg
tacgctttttctgagaactatgtcttgcctttttctcatgacgaggtggtgtatgggaaa
agatcattgcttgagaaaatgccagggactctatggcagaaatttgcacagcttcgtttg
cttctaggctttatgtacgcccatccaggaaaaaaactcttgtttatgggaagtgacatt
gctcagagggcggaatggaatcacgaggagtctcttcactggaatcttcttaaagaccct
tttcatagtggaatgcagctgtgggtccgggatataaatagagtatatttcgaggagaag
gctcttcatgaaaaagatttttcatcagaagggtttcaatggattgattgctcagacagt
aaagcaagtgttttgggttttattcgaagagatggagaagaggggaaggtgctggctatt
ttcaactttacccctgtagttcgccacaactaccttgtcggtgttcctgaagcgggctat
tggcgcgaattgcttaatagtgacggagaaatatatggaggaatgggagaagggaatatg
ggagggaaagaagcgatggaggaacctttgcagcgtcagccctgctgtctgtcgttgacc
cttccgtcttttggcgccctttttttcagaaaagagggatag

DBGET integrated database retrieval system