KEGG   Aminobacterium colombiense: Amico_0344Help
Entry
Amico_0344        CDS       T01202                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aco  Aminobacterium colombiense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amico_0344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_0344
   00052 Galactose metabolism
    Amico_0344
   00500 Starch and sucrose metabolism
    Amico_0344
   00520 Amino sugar and nucleotide sugar metabolism
    Amico_0344
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amico_0344
   00524 Butirosin and neomycin biosynthesis
    Amico_0344
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amico_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
360474..361463
Genome map
AA seq 329 aa AA seqDB search
MHILTADIGGTTSRFALFSVRDKKVFLEKIIRKATARYASFFEILEEIRMEDGRFSFDEV
LFSVLALPGPVRKQDDIALTNVTWPIPIASLRRAYSQAPLLVVNDFIAQAYGCLTLHKGD
YFTVNEGQMDPEGHVAVIGAGTGLGCGVLVPYAFQKYAPLPSEGGHTTFAFLKEEQSFEV
FLRKRTSASYITKEMVVSGKGLSLLYEFLTGHSLTPLEVAEKISPSSLTAMLFATFYARA
CRDFALTVTPSRGLFISGGVAISNPWIVDNDIFKKEFTFSSSHSAFLNTIPVLLLKNVDN
GLWGAVHYGIHCLPEFEQTMGVEDSFSYL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgcatattctaactgcggatattggcggaactacaagtcgttttgcacttttttccgta
agggataagaaggtctttctcgaaaagattattcgaaaggcaacggccagatatgcgtct
ttctttgaaattttagaagagattcgtatggaagacggcagattttcctttgatgaagtg
ctgtttagtgtgcttgctcttcctggccctgtaagaaaacaagatgacatcgctttgacc
aatgtgacctggcccataccaatagcctctcttcgacgagcttatagtcaagcccctctt
ttggtagtaaatgattttattgcccaagcctatggttgcttaaccctccataagggggac
tatttcacagtcaatgaaggacagatggatccggaaggacatgttgcagtgataggggca
ggaacaggtctaggatgcggcgtgcttgttccatatgcttttcagaaatatgcccccctg
ccatctgaggggggccacacaacctttgcttttctcaaagaagagcagtctttcgaggtt
tttctcaggaaaaggacttcggcctcttacatcacaaaagaaatggtggtttccggaaaa
ggcctgtcccttctttatgagttcttaacgggacactctttaacccctctggaagtagcg
gaaaagataagtccgtcatctcttactgccatgctatttgctacattttatgccagagcc
tgcagggattttgctttaaccgtaaccccttccagaggactttttatctctggcggcgtg
gctatctccaatccatggatcgttgataacgatattttcaagaaagaattcactttttcc
tcttcccatagcgcctttctcaacactatcccggtgttgttgcttaaaaatgtcgataat
gggctctggggcgcagtacattatggcattcactgtttaccggagtttgagcaaactatg
ggagttgaagattctttttcatatttgtaa

DBGET integrated database retrieval system