KEGG   Aminobacterium colombiense: Amico_0419Help
Entry
Amico_0419        CDS       T01202                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aco  Aminobacterium colombiense
Pathway
aco00010  Glycolysis / Gluconeogenesis
aco00030  Pentose phosphate pathway
aco00051  Fructose and mannose metabolism
aco00052  Galactose metabolism
aco00230  Purine metabolism
aco00500  Starch and sucrose metabolism
aco00520  Amino sugar and nucleotide sugar metabolism
aco00521  Streptomycin biosynthesis
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_0419
   00030 Pentose phosphate pathway
    Amico_0419
   00051 Fructose and mannose metabolism
    Amico_0419
   00052 Galactose metabolism
    Amico_0419
   00500 Starch and sucrose metabolism
    Amico_0419
   00520 Amino sugar and nucleotide sugar metabolism
    Amico_0419
  Nucleotide metabolism
   00230 Purine metabolism
    Amico_0419
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amico_0419
Enzymes [BR:aco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Amico_0419
    5.4.2.8  phosphomannomutase
     Amico_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADE56561
JGI: Amico_0419
UniProt: D5EDC9
Position
complement(448452..449837)
Genome map
AA seq 461 aa AA seqDB search
MQVPKHIFREYDIRGIADTELTEKTVTAIGKAYGTFLYREGITSITVGGDVRLSTDRIKK
NVIDGVTWAGIHVTDIGVATSPLLYWSQFRFNFDGGIMVTGSHNPKDMNGLKLAYGKSTM
YGEQIQLILSMIEKDDFEKGPAPGTIKKANIWEEYIAMLLSKIKLGPRKLKVAADAGNGT
AGLYIQTFLEKLGCEVVPLFCEPDGTFPNHHPDPLKRENLTFLIEKVRQEKADLGIAFDG
DADRIGVVDEKGTVIWGDTLMGLYWREILPKYPGAVAIIEVKCSQALEDEILRLGGKPLY
YKAGHSLIKAKMKEVDALFAGELSGHMFFADEFYGFDDSFYAAGRLLRILSNDARSLSEM
LVDYPVYYSTAEIRVDCPDEKKFQVIEKIKEEALKDHDAITIDGVRILYDRRGWGLVRAS
NTQPVLVTRCEGKTQEDLDHITRDMKQRMLDVGIPDFEWTY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaccaaaacatatttttagagaatatgacattcgcggaatagccgacaccgaa
ctcactgaaaaaacagttaccgctatcggcaaggcatacgggacattcctttacagagag
ggaattacgtcgattaccgtaggaggggacgtaaggctctctacagaccgaatcaaaaaa
aatgtcatcgatggcgtaacgtgggcaggaattcatgttacggatattggggttgccacc
tctccccttctttattggagtcagttccgcttcaattttgatgggggtattatggtaacg
ggcagccataaccccaaagatatgaacggcttaaaattggcttatggcaagagcaccatg
tacggagagcaaatacaactaatcctctcaatgatagagaaggatgacttcgaaaaaggc
cctgctccagggacaataaaaaaagcaaatatctgggaagaatatattgccatgcttctc
tcaaagataaaactgggacccagaaaactaaaagtggcagcagatgctggcaatggaacc
gctggcctttatattcaaaccttccttgaaaaactgggatgtgaagtcgttccccttttc
tgtgaacctgacgggacatttccaaaccatcatccagatccccttaaaagagaaaatctc
acctttctaatagaaaaagtgaggcaggaaaaagcagatctggggatcgcttttgatgga
gacgccgatcgtattggcgtagtagatgaaaaaggaacagtcatatggggagacaccctc
atgggactctattggcgtgagattctccctaaatatcctggggccgtggcaattatcgaa
gtcaagtgttcacaggcccttgaagatgagattttgagacttggtgggaaaccgctttat
tacaaggcaggacactctcttattaaagcaaagatgaaagaagtggatgccctctttgca
ggagaactttctggccatatgttctttgctgatgagttttacggctttgatgattctttc
tatgctgcgggacgacttctcagaattctctctaacgacgcgcggtctctttcagaaatg
ctcgttgactatcctgtctactacagcactgctgaaatacgggtagactgccccgatgaa
aagaaatttcaggttatcgaaaaaataaaggaagaagccctcaaggatcacgatgccatt
accattgatggtgtgaggattctctatgaccggcgtggatgggggcttgtgagggcgtca
aacactcagccggtgcttgttactcgatgcgaggggaaaactcaagaggatctggaccat
attacaagagatatgaaacagcgaatgttagacgttgggattcccgattttgagtggaca
tactaa

DBGET integrated database retrieval system