KEGG   Aminobacterium colombiense: Amico_0451Help
Entry
Amico_0451        CDS       T01202                                 

Definition
HsdR family type I site-specific deoxyribonuclease
Orthology
K01153  
type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
aco  Aminobacterium colombiense
Brite
Enzymes [BR:aco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Amico_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
482108..485302
Genome map
AA seq 1064 aa AA seqDB search
MAFCECHLEEAALEWFEELGYEVVFAPDIAPEGTYPERTYYSDVVLTERLKEALARINPD
LPDDALEDGFRQIMFPQSPSLIMNNKTFQKMITDGIDVQVKQEDGGYRTEKAYIFDLEAP
SNNDFLVANQFTVVEHDKEKRPDIVVFVNGIPLVVIELKNASDENVDITDAFNQLQTYKK
TIPSLFTYNSFTVISDGVNARAGTLTSNEDRFMAWRTIDGDDVAPLCIPQLEVLIKGMFL
KDRFLDIIRHFVLFQSDGKEIKKILAGYHQYHAVNKALQSTQRATMEQGDRRVGVIWHTQ
GSGKSLSMVFYAGKLVIDEELENPTIVVITDRNDLDDQLFSTFLKSEELLRNTPVQAQDR
VHLRELLNNRTSGGIIFTTIQKFAPFTNETNGEVIDFNRWGRVAENSSPYTANTMLTDRR
NVVVIADEAHRSQYGFGAEIVMGKTEADVKYGYAKYMRDSLPNASYIGFTGTPVELTDKN
TRVVFGDYIDIYDMTRAVEDGTTVKIFYESRIAKLDLPEEMKPQIDSEYEEITEYQEYSQ
KERLKSKWARLEAIVGTEQRIKQIAKDIVEHFEKRDLAQENEGGKGMIVAMSRRIAIDLY
KEIVALRPDWHSDDLMSGKIKVVITGSSSDPSDWQAFIGSKADRETLAKRMKDRNDELKL
VIVRDMWLTGFDVPSMHSMYVDKPMSGHNLMQAIARVNRVFKEKQGGLVVDYIGIAENLK
NALAQYTESDKKTTGVDTEVASQVLLEKYDLIKELLHGHSYEKFFTGRQSEKMQAITETM
DFIIGLREDRKNDYINLVTEMARAYSLCATTDTAETLNVEVGFHKAVRACLHKIMSDGSK
KKTTSQLDNELNQLISKAISSNEVVDILSSVGLSKPNIAILSDEFLEEVKGMRQKNLAVE
LLNRLLKGSIKNFSRRNLVQSKRFSEMLEASIRKYQNRTIETTQVIMELIELAKEISGAE
KRGESTGLTSDELAFYDALADNESARDVMGDEILMQIAKDLTLSIRRNISVDWAIRENVQ
AKMKMDIKRLLKRYNYPPDKTPQAVDTVIAQAKLMCQKEVAYGS
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggctttttgcgagtgccatttggaagaagccgctcttgaatggtttgaagaactaggt
tatgaggtggtttttgcaccagatattgctccagaaggaacatatcctgaacgtacctat
tatagcgatgtagtactgacagagagattaaaagaggctcttgcacgaataaatccagat
cttcctgacgatgcgctggaagatgggtttaggcagataatgtttcctcagagccctagc
ctcattatgaacaataaaaccttccagaaaatgatcactgatggcattgacgttcaggta
aaacaggaagatggcggatatcgcactgaaaaagcctatatttttgatttagaagcacct
tccaacaatgactttttagtagcgaatcagtttactgttgtagagcatgataaagaaaaa
cgaccagatatagttgtatttgttaatggcattccattggtcgttatagaactgaaaaat
gcaagtgacgagaatgtagatattactgatgcttttaaccagcttcaaacctataaaaag
actattccttccttgtttacgtataattcctttacggttatcagtgatggtgtaaatgcc
agagctggaactctcacatctaatgaagaccgctttatggcttggcgcactattgatggt
gatgatgtggcacccctctgtattcctcagcttgaagtattgattaaaggaatgtttttg
aaagaccgcttccttgatattatcaggcatttcgtgttgttccaaagtgatggtaaagaa
atcaaaaagattttggcaggatatcatcagtatcatgccgtaaataaggctcttcaaagc
acccagcgcgcaacgatggaacaaggtgatagaagagtaggcgttatttggcatactcag
ggcagcggtaaaagcctttctatggttttttatgcggggaaactggttattgatgaagaa
cttgaaaacccgacaattgtagttattacagatagaaacgatttggacgaccagctgttc
agcacgtttcttaaaagcgaagagctcttaagaaatacgccggtacaggcacaagacaga
gttcatcttagagagcttctgaataaccgtaccagcggcggcattatctttacaaccatt
cagaagtttgccccttttaccaatgagacaaatggagaagtgatagattttaatagatgg
ggcagggttgcggaaaattcttctccctacactgcgaatacgatgcttacagatcggcgg
aatgtggttgttattgccgatgaggctcacagaagtcaatacggttttggtgcagaaatt
gtaatgggaaaaacagaagcagatgtaaagtacggttatgcaaagtatatgcgggacagc
cttcccaacgcttcttatataggctttacaggaacacctgtagaactgacagataaaaat
acgagagtggtttttggggattatatcgatatctatgatatgacaagggctgtagaagat
ggcacaacggttaagattttttatgaaagcagaattgctaaattagacctgccggaagaa
atgaaacctcagattgattcagaatacgaagaaatcactgaatatcaggagtatagccag
aaagaaaggcttaagagtaaatgggccaggcttgaagctatagttgggacggagcagcgg
ataaagcagattgcaaaagatatcgtagagcattttgaaaaacgggatctggctcaggaa
aacgaaggcggcaaaggaatgattgttgccatgagccgcagaatcgccatagacctctat
aaagaaatagttgctctgcgtcccgattggcacagcgatgacttaatgtctgggaaaatc
aaagttgttataacgggcagttcttctgacccatcagattggcaagcctttattggctcg
aaagcggatcgtgaaaccctggctaaacggatgaaagatagaaatgacgagcttaagctg
gttattgtccgagatatgtggctcacggggtttgatgtgccgagcatgcattcaatgtat
gtagataaacctatgagcgggcacaaccttatgcaggccatagcgagagtgaatcgggtt
tttaaagaaaaacaaggcggactcgttgttgattatattggtattgcagaaaacttgaaa
aatgcgcttgcacaatatacagaaagcgataagaaaacaaccggagtagatactgaggtg
gcatctcaggttcttttggagaaatacgacttaataaaggaactgcttcacgggcatagt
tacgaaaaatttttcacgggcaggcagagtgagaagatgcaagccattacggaaacaatg
gattttattattggacttcgagaagatagaaagaacgattatattaatctagtgacggaa
atggcccgggcgtattcgctgtgtgctacaacagatactgctgaaacacttaacgttgaa
gtaggatttcacaaagccgtaagggcatgtctacacaaaataatgagtgacgggagcaaa
aagaaaaccacatcccagctagataacgaacttaaccagttgatttcaaaggcgatttcc
tctaatgaagtggttgatattttaagttctgttggtctctcgaaacccaatattgctatt
ctttcagatgaattcttagaggaagtaaaaggaatgcggcagaaaaacttggcagtggag
ttgttgaatcgattgctcaaaggtagcatcaaaaacttttcaagacgcaaccttgttcaa
tcgaagaggttctctgaaatgcttgaagcctccataagaaaatatcagaacagaactatt
gaaaccactcaggtaattatggaattgattgagcttgccaaagaaattagtggcgcggaa
aaacgtggagagagcacggggcttacctcggacgaattagctttttatgatgcgctggct
gataatgagtcggcccgggatgttatgggagacgagatcttaatgcagatagcaaaagac
ctgacgctatctattagaaggaatatcagcgtagactgggctattcgtgaaaatgtacag
gcaaagatgaaaatggacatcaagcggctgttgaagcgctataactaccctccggataaa
actccccaagcagtggatactgtgatagcgcaggcaaaactcatgtgccaaaaagaagtt
gcatacggaagctaa

DBGET integrated database retrieval system